Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032384 (Csnk1g1)
Chromosomal location
Chr 9: 65756817 - 65892821 (+)
Description
casein kinase 1, gamma 1 Gene [Source:MGI (curated);Acc:Csnk1g1-001]
RefSeq_dna
NM_173185 
RefSeq_peptide
NP_775277.2 
UniGene
Mm.471281 Mm.325816 
MGI
MGI:2660884 
Uniprot/SWISSPROT
Q8BTH8 
Uniprot/SPTREMBL
Q6P2B2 
Human Ortholog
ENSG00000169118 (CSNK1G1)
Omim not available
UniTrap UNI1191
Vector Insertion
Chr 9: 65756976 - 65757245
Public Clones CE0461 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30122
Vector Insertion
Chr 9: 65757470 - 65797822
Public Clones (ggtc) D111C01 (ggtc) IST11627E10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18445
Vector Insertion
Chr 9: 65806135 - 65806529
Public Clones not available
Private Clones OST423255 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8828
Vector Insertion
Chr 9: 65828780 - 65847201
Public Clones TEA218 (baygenomics)
Private Clones OST40048 (lexicon)
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6436
Vector Insertion
Chr 9: 65847354 - 65849853
Public Clones CSA078 (baygenomics) CSA077 (baygenomics)
Private Clones OST444222 (lexicon)
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3335
Vector Insertion
Chr 9: 65867720 - 65880045
Public Clones AB0249 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000117849
Sequence
GGCCAATGCAGACCGGGAGTTTCCCACCTGGAGTGCCAGCTCCGAAAAGAAGGGGGAGCATCATCCAGGGCCGAAATCAAGGGTATAGACTTGGAGAGGT

GACTGTGGTCATCCTGTGCTTCACATTGTCCGCGTCCCGGACTCTCTGTTGGGACAGAGCCGGGCTTCGAGGGCTTGTAAGGGTTTCGTGTCGGCTGGGC

ACCGTGGAGCCGCCCTTGGCAGAG - UNI18445 - - UNI30122 - GTTACAAAATGTCCTTCTATGCATGAGATCTACGGACTATATGTTCTTC

AAGAACTGATCAGTGGTTTTCACCTTCTGGAAGAACACTAGAAGCATAAATATGGTGCCAAAACTCCTCATTCTCTGACTGTGGTGATTTGGACATACTT

CTGTGTGGAGGAGAAGTATACACGCTGAGGTCACTCATTGTTCAGAGACTGTCGTGTAGGAACATGGACCATTCTAATAGGGAAAAGGATGATAGACAAC

GGACAACTAAAACCATGGCACAAAGGAATACACACTGTTCGAGACCATCTGGCACTTCAACATCCTCTGGGGTTCTCATGGTGGGACCCAACTTCAGGGT

TGGCAAGAAGATAGGGTGTGGGAACTTCGGAGAGCTCAGATTAG - UNI18445 - GTAAAAATCTCTACACCAATGAATATGTAGCCATTAAACTG 

GAACCAATAAAATCACGTGCTCCACAACTTCATTTAGAGTACAGGTTTTATAAACAGCTTGGCAGTGCAG - UNI8828 - GTGAAGGCCTCCCACAG

GTTTATTACTTTGGACCATGTGGGAAGTACAATGCCATGGTGCTGGAACTCCTTGGCCCTAGCTTGGAAGACTTGTTTGACCTCTGTGACCGAACGTTTA

CTTTGAAGACGGTGTTAATGATAGCCATCCAGTTG - UNI6436 - CTTTCTCGAATGGAGTATGTACACTCAAAGAATCTTATTTACCGAGATGTCA

AACCAGAGAACTTCTTGATTGGCCGACAAGGCAATAAGAAAGAGCATGTAATACACATTATAGATTTTGGACTGGCCAAGGAATATGTTGATCCTGAAAC

CAAAAAACACATACCTTACAGAGAGCACAAAAGTTTGACTGGAACTGCGAGATACATGTCTATCAACACACATCTAGGCAAAG AGCAAAGCCGGCGAGA

TGATTTGGAAGCCTTAGGCCATATGTTCATGTACTTCCTCCGAGGCAGCCTACCCTGGCAAGGACTCAAG GCTGATACATTAAAAGAGAGATATCAAAA

AATCGGTGATACCAAAAGGAATACTCCCATCGAAGCTCTCTGTGAGAACTTTCCAG AGGAGATGGCAACCTACCTTCGATATGTCAGGCGATTAGACTT

CTTTGAAAAACCTGATTATGAGTATTTACGGACCCTCTTCACAGATCTGTTTGAACGGAAAGGCTATACCTTTGACTATGCCTATGATTGGGTTGGAAGG

CCTATT CCTACTCCAGTAGGATCAGTTCATGTAGATTCTGGTGCATCTGCAATAACTCGAGAAAGCCACACACACAGGGATCGGCCATCACAACAACAG

CCTCTTAGAAATCAG - UNI3335 - GTGGTTAGCTCAACCAATGGAGAGCTGAATGTCGATGACCCCACTGGAGCTCACTCCAATGCACCAATCACA

GCTCATGCCGAAGTGGAGGTAGTGGAGGAAGCTAA CTGCCTGAAAATGCTCAACCTGTG GTGCTGCTGTTTCTTTAAGAGGAAAAGGAAGAAGACAGC

CCAGCGACACAAGTGACCAGTGCCTCCCAGGAGTCCTCAAGTCCTGGGGACTCTGGCTCCAATTGCACCTGCAGCTCCTGCCATTTCTCATTGGAAGGGA

CTCCTCTGTGGGGGAGGGTAGAGATCCAAACCAAAAAGAAGAAAACAGATGCCCCCAGAAGGAGCCAGTGCAGGCAGCCAGGGCCGAGTGGGCCAGTGGC

AATCCCCTCTGTCTGAGCTCTGAGCGGGTCCAGAGCTGCTGCTTCTCCACTGCTTGCCCTTGGGCTATCTGGTTGACTCTCTTCCCATTGTTTACAGTGA

AGGTGTCATTCACAAAAACTCAAGGACTACTATTCTCTTCCCCCCTTTTTACTCCTGGCTCTTGCACCATCCTCAACCCTCTCCAGCATAAAGAAACTAC

TAAGCTAAAGGCTCTATCAAGAAGCTGGTGGTGTGGCCAAGAAGATAGGGGAAGATGACAGCCCTGGGCTGGAGAACTTCTCCACTTCCCAGGTGTGTCT

GGTAGTGTGGCTTCCTCTCCCTCTGTGCCTGGGTAACCCCTCAGCCCAGCTGGCCACAGGGTTCAGGTCCCTTCCTTTGTCCTTCCCTTCCTCCCTCCCT

CCTTCCCTCCTGTGAAGTTACACTGTAGGACACAAGCTGTGAGCAGTCTGCAGTCTACTGTCCCTGTGTGTTGGCGTTCTTAGCTTTTTTGACAAGCAGA

TCCCTTGCTCCGGGCTGTAGCAAAATATGCCTGTGGTTCTGAGCAAAGGAAAGGAAACTGACTTTATTGCACTTTTAGTTTTTTGGGTTTTTGTTTTTAT

TTTATAAACAACATGGCAGATGCATATTGTGTCTGGTTATATTGGGGGGTTTGTTTTTTTTTTTTTTTTCTTTTTCAAGGGGGATGGGCCAGCCAAGCCA

TTCAGAGAAAATGTGGGTCCAGAGGACATTTTTGATGGAAAGAGTCTGATTTGCAGCACTTGGAAGAGAAGAAGCCAAACTCTGCGTCATCCTGAGTAAT

ATTCAGGTTGGCAAGGAAACATACTTGAATTTTCATTCATCTTCTCTGCTGCAGAAAAAAGTCCAGAGCCCTGACCTAATCAATCAGCCCAGACCTAATC

AATCAGCCCAGAGCTTGAGCCCAGCTCCTGAGCCCGTGGGATGAGCACCGAGCCAGACTGTGACCAACCAGAAGGCACCTCGTCTCAGAGAGGAGATACT

GAACAACAACAACAAAGCAAATTTCTGTTTCCTCCACTGCCAGGGACTTCCTACTAGATAGCCATGTGACTTTCTGTTGACTCGGGGGACAAAATTAGTG

ACTAAACACCCACCACCGTATTGCCAGTAGTGGACAAAAGAAGGCACCACATTTGCCTTCCAACTGCCAGAGGAGTCTCAGGATGCAGCATCCTAGGGCC

AGGAAAAGAAAATATTTTCTGTCTGCCTGAAGTGAGCTAGAACATGTGGGTCAGTCTGCCTTAGAAACCATGCCTGTGATAATTTTGGAGCATATCCATA

GCAACAGGCTTAGAACGTGGTACATGGGGCTGCTGCAAGCAGAGAAGGTAAGATTGGTTGGTGCTAGGAAATTCCAGGGAAAAGGAAACTGTAATGAAAG

GTCTAAAATTTTATCTAAACAATCGAACAGAGACTGTCCAGACAGTATGACCACATATCTTAGCATGTTTTCCCCGGTACACACTCTATCTGCTACGGTG

AAGCATCACTGGTTGCACAGTTAACAGTGTGTGGGGTTACTCCTCCCATGTTCTATTTTATTTGAGATTAGTGGCATTTCCAGATAGTAACTTCTTATGC

TAGTTGTGGCAAAAAGGCTTATTCACGTGGGTAAAGAGGTCTTGTGTTTGGGTATAAAGAACTAACCACCGAGAGCAGTGGCTAGTGACTTAGTACAGCA

CAGAACTCTTTGCTTTTATATGTAGAGGACTGGACTGGAAGATGTCAGGACACTTGTGGTCATGGATCAAATTTAGTATCAAATGAAGCAGAGTTTGTGC

ACCTTACCTGTTCTATTGGACTGTGGCTAGGGAATCTCCTCACTGACTTCAAACCTGGTTAGCATTTGTAAATATTGCCACCTGGCCATTTCTTTACAAG

AAATGTTTTTGTCTGTGAATCAGAGTGGCAGGGAGAAGTCAGGTCAGACCCCTTCCCCATAAGGAGTTGGAGTGTTAGGATTTGCTTCCTTTTTACTATA

TAGTAGTTAAAGCTCATCACTAACATTTATACAGTCCCTCATTTGGCATGTGGGCAACTCTGACTTCCCCTACAGAAACTTAAAAGTCTTTATCCCAGGA

AATGGTGGCAACCTGGCACTCTCTGCCCTACTAAGTGCCTCCCCCACCCTGCTTCCAAGGTAAAGTAAAGGCAGTGACCAGCTTGGCTGCAGGGTGGGAT

GCCCTGCAGCTGGGCTTAAGACTTCTTTTTTGTCTTAAAATATTTTTATAGGCTAGCTCTTGAGGGGTTAAACCTGAGTGGTTTGTGTATGTGGGGGAGT

GTCCTTCCTAATGCACTGTTGGCACCCTCCAGCACCCACAAATCCCTTACTAGGTATTTGGGTTTTGTAGCAAAGGTCCCTTTAACGTGCAGGGTGGTGG

TGATCCTTTCAAGGCCAGTGACACGCCAAGGTGATCCCAAACCTGAGGAATTCTCATCTTCCTTAAAGTTAAAATAGAACTAAATTCCCCCAAAACACTC

TTCTCATCATTTCAGCCCCCACCCCCAGCCCAGCACTTGAGGCTTCATGCACATCCCTGCTTCTTTTACCTGCCTGACTGCAAGCTCAGCAGATCCTCGG

GCACAGGCAACCCCCTCCATCTCCTTGCATCCAGGTCCACTTGCTCCATCTCACCCGACACTTGAGACAGCAGGCATTTGATACTGTACTATCTGGAGTT

TCCTCGAGCTTTGCTGTCCTTGAGACATTGCAGTTTGAGCAGACTGAGGTCCAGCCAGGCCAGGGTTACACCAGGGTGTAAAGTGTTCAGTCATATAAGT

GGATTTTCAGAATTCTTGCTCCAGACTGCCCCCAAGGCTGCACTGAATGTCCCAGCAGCTGGTGAACACTCATGACTGCCTTAACATTCTTCTACTTCGG

GTCTGTCCAGGAGCAAACAGGGTCTGTGAAGATGTCTGAGTCAGGCGACTAGGTAAGTCTCCAGTTAAAAGTCCCATTTCGATTGGAACAAACTGCAGGA

AACAGCAAGTCCCCAAGATTTCTGAAAGTGTTCACTTCCTTTTCATTTTTAGTGAATGACAAGAACTCAGAAGCACCCCGTGTCCATTAGCCAGATGGTG

TACATCTTCTGTAAAATAACTTCCAGTTTAGTTCAGAAGGAAAGTGTGCTGTAGTGCTTATTTAGTGTTGATGTTCAATGTTAGCAACCACTTGAATTGC

CAGAAGTATGCTATGTTAAAGTGGTTGCTAAGGATCATAGCCTTAATTTAAAAAAAAAAA
Translation
 - UNI18445 - - UNI30122 - MDHSNREKDDRQRTTKTMAQRNTHCSRPSGTSTSSGVLMVGPNFRVGKKIGCGNFGELRLG - UNI18445 

- GKNLYTNEYVAIKL EPIKSRAPQLHLEYRFYKQLGSAG - UNI8828 - GEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLM

IAIQL - UNI6436 - LSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYVDPETKKHIPYREHKSLTGTARYMSINTHLGKE EQ

SRRDDLEALGHMFMYFLRGSLPWQGLK ADTLKERYQKIGDTKRNTPIEALCENFPE EEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYA

YDWVGRPI PTPVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQ - UNI3335 - VVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEAN NCLKM

LNLW WCCCFFKRKRKKTAQRHK
Transcript ENSMUST00000085436
Sequence
TGGTCTTCCCCCTCCCCTCCGCCTCCTCCGCTCCCTCCGCTCCCTCCCGCTCCTGGGAAAGCAAAGCTGCGGCTTAAGGGGTGGTTGAGAGAAGCAGTAG

GCGCCTCGGGGAGGGGACCGCGCCCGCCCCCTTGGAACACTGGAGCACCGCTGATTTAG - UNI1191 - - UNI30122 - GAGGACAGGTGTGAG

GCCAGTGCACCTTTGACCCAATGGGGCTTAACTG - UNI18445 - GTTACAAAATGTCCTTCTATGCATGAGATCTACGGACTATATGTTCTTCAAG

AACTGATCAGTGGTTTTCACCTTCTGGAAGAACACTAGAAGCATAAATATGGTGCCAAAACTCCTCATTCTCTGACTGTGGTGATTTGGACATACTTCTG

TGTGGAGGAGAAGTATACACGCTGAGGTCACTCATTGTTCAGAGACTGTCGTGTAGGAACATGGACCATTCTAATAGGGAAAAGGATGATAGACAACGGA

CAACTAAAACCATGGCACAAAGGAATACACACTGTTCGAGACCATCTGGCACTTCAACATCCTCTGGGGTTCTCATGGTGGGACCCAACTTCAGGGTTGG

CAAGAAGATAGGGTGTGGGAACTTCGGAGAGCTCAGATTAG - UNI18445 - GTAAAAATCTCTACACCAATGAATATGTAGCCATTAAACTG GAA

CCAATAAAATCACGTGCTCCACAACTTCATTTAGAGTACAGGTTTTATAAACAGCTTGGCAGTGCAG - UNI8828 - GTGAAGGCCTCCCACAGGTT

TATTACTTTGGACCATGTGGGAAGTACAATGCCATGGTGCTGGAACTCCTTGGCCCTAGCTTGGAAGACTTGTTTGACCTCTGTGACCGAACGTTTACTT

TGAAGACGGTGTTAATGATAGCCATCCAGTTG - UNI6436 - CTTTCTCGAATGGAGTATGTACACTCAAAGAATCTTATTTACCGAGATGTCAAAC

CAGAGAACTTCTTGATTGGCCGACAAGGCAATAAGAAAGAGCATGTAATACACATTATAGATTTTGGACTGGCCAAGGAATATGTTGATCCTGAAACCAA

AAAACACATACCTTACAGAGAGCACAAAAGTTTGACTGGAACTGCGAGATACATGTCTATCAACACACATCTAGGCAAAG AGCAAAGCCGGCGAGATGA

TTTGGAAGCCTTAGGCCATATGTTCATGTACTTCCTCCGAGGCAGCCTACCCTGGCAAGGACTCAAG GCTGATACATTAAAAGAGAGATATCAAAAAAT

CGGTGATACCAAAAGGAATACTCCCATCGAAGCTCTCTGTGAGAACTTTCCAG AGGAGATGGCAACCTACCTTCGATATGTCAGGCGATTAGACTTCTT

TGAAAAACCTGATTATGAGTATTTACGGACCCTCTTCACAGATCTGTTTGAACGGAAAGGCTATACCTTTGACTATGCCTATGATTGGGTTGGAAGGCCT

ATT CCTACTCCAGTAGGATCAGTTCATGTAGATTCTGGTGCATCTGCAATAACTCGAGAAAGCCACACACACAGGGATCGGCCATCACAACAACAGCCT

CTTAGAAATCAG - UNI3335 - GTGGTTAGCTCAACCAATGGAGAGCTGAATGTCGATGACCCCACTGGAGCTCACTCCAATGCACCAATCACAGCT

CATGCCGAAGTGGAGGTAGTGGAGGAAGCTAA CTGCCTGAAAATGCTCAACCTGTG GTGCTGCTGTTTCTTTAAGAGGAAAAGGAAGAAGACAGCCCA

GCGACACAAGTGACCAGTGCCTCCCAGGAGTCCTCAAGTCCTGGGGACTCTGGCTCCAATTGCACCTGCAGCTCCTGCCATTTCTCATTGGAAGGGACTC

CTCTGTGGGGGAGGGTAGAGATCCAAACCAAAAAGAAGAAAACAGATGCCCCCAGAAGGAGCCAGTGCAGGCAGCCAGGGCCGAGTGGGCCAGTGGCAAT

CCCCTCTGTCTGAGCTCTGAGCGGGTCCAGAGCTGCTGCTTCTCCACTGCTTGCCCTTGGGCTATCTGGTTGACTCTCTTCCCATTGTTTACAGTGAAGG

TGTCATTCACAAAAACTCAAGGACTACTATTCTCTTCCCCCCTTTTTACTCCTGGCTCTTGCACCATCCTCAACCCTCTCCAGCATAAAGAAACTACTAA

GCTAAAGGCTCTATCAAGAAGCTGGTGGTGTGGCCAAGAAGATAGGGGAAGATGACAGCCCTGGGCTGGAGAACTTCTCCACTTCCCAGGTGTGTCTGGT

AGTGTGGCTTCCTCTCCCTCTGTGCCTGGGTAACCCCTCAGCCCAGCTGGCCACAGGGTTCAGGTCCCTTCCTTTGTCCTTCCCTTCCTCCCTCCCTCCT

TCCCTCCTGTGAAGTTACACTGTAGGACACAAGCTGTGAGCAGTCTGCAGTCTACTGTCCCTGTGTGTTGGCGTTCTTAGCTTTTTTGACAAGCAGATCC

CTTGCTCCGGGCTGTAGCAAAATATGCCTGTGGTTCTGAGCAAAGGAAAGGAAACTGACTTTATTGCACTTTTAGTTTTTTGGGTTTTTGTTTTTATTTT

ATAAACAACATGGCAGATGCATATTGTGTCTGGTTATATTGGGGGGTTTGTTTTTTTTTTTTTTTTCTTTTTCAAGGGGGATGGGCCAGCCAAGCCATTC

AGAGAAAATGTGGGTCCAGAGGACATTTTTGATGGAAAGAGTCTGATTTGCAGCACTTGGAAGAGAAGAAGCCAAACTCTGCGTCATCCTGAGTAATATT

CAGGTTGGCAAGGAAACATACTTGAATTTTCATTCATCTTCTCTGCTGCAGAAAAAAGTCCAGAGCCCTGACCTAATCAATCAGCCCAGACCTAATCAAT

CAGCCCAGAGCTTGAGCCCAGCTCCTGAGCCCGTGGGATGAGCACCGAGCCAGACTGTGACCAACCAGAAGGCACCTCGTCTCAGAGAGGAGATACTGAA

CAACAACAACAAAGCAAATTTCTGTTTCCTCCACTGCCAGGGACTTCCTACTAGATAGCCATGTGACTTTCTGTTGACTCGGGGGACAAAATTAGTGACT

AAACACCCACCACCGTATTGCCAGTAGTGGACAAAAGAAGGCACCACATTTGCCTTCCAACTGCCAGAGGAGTCTCAGGATGCAGCATCCTAGGGCCAGG

AAAAGAAAATATTTTCTGTCTGCCTGAAGTGAGCTAGAACATGTGGGTCAGTCTGCCTTAGAAACCATGCCTGTGATAATTTTGGAGCATATCCATAGCA

ACAGGCTTAGAACGTGGTACATGGGGCTGCTGCAAGCAGAGAAGGTAAGATTGGTTGGTGCTAGGAAATTCCAGGGAAAAGGAAACTGTAATGAAAGGTC

TAAAATTTTATCTAAACAATCGAACAGAGACTGTCCAGACAGTATGACCACATATCTTAGCATGTTTTCCCCGGTACACACTCTATCTGCTACGGTGAAG

CATCACTGGTTGCACAGTTAACAGTGTGTGGGGTTACTCCTCCCATGTTCTATTTTATTTGAGATTAGTGGCATTTCCAGATAGTAACTTCTTATGCTAG

TTGTGGCAAAAAGGCTTATTCACGTGGGTAAAGAGGTCTTGTGTTTGGGTATAAAGAACTAACCACCGAGAGCAGTGGCTAGTGACTTAGTACAGCACAG

AACTCTTTGCTTTTATATGTAGAGGACTGGACTGGAAGATGTCAGGACACTTGTGGTCATGGATCAAATTTAGTATCAAATGAAGCAGAGTTTGTGCACC

TTACCTGTTCTATTGGACTGTGGCTAGGGAATCTCCTCACTGACTTCAAACCTGGTTAGCATTTGTAAATATTGCCACCTGGCCATTTCTTTACAAGAAA

TGTTTTTGTCTGTGAATCAGAGTGGCAGGGAGAAGTCAGGTCAGACCCCTTCCCCATAAGGAGTTGGAGTGTTAGGATTTGCTTCCTTTTTACTATATAG

TAGTTAAAGCTCATCACTAACATTTATACAGTCCCTCATTTGGCATGTGGGCAACTCTGACTTCCCCTACAGAAACTTAAAAGTCTTTATCCCAGGAAAT

GGTGGCAACCTGGCACTCTCTGCCCTACTAAGTGCCTCCCCCACCCTGCTTCCAAGGTAAAGTAAAGGCAGTGACCAGCTTGGCTGCAGGGTGGGATGCC

CTGCAGCTGGGCTTAAGACTTCTTTTTTGTCTTAAAATATTTTTATAGGCTAGCTCTTGAGGGGTTAAACCTGAGTGGTTTGTGTATGTGGGGGAGTGTC

CTTCCTAATGCACTGTTGGCACCCTCCAGCACCCACAAATCCCTTACTAGGTATTTGGGTTTTGTAGCAAAGGTCCCTTTAACGTGCAGGGTGGTGGTGA

TCCTTTCAAGGCCAGTGACACGCCAAGGTGATCCCAAACCTGAGGAATTCTCATCTTCCTTAAAGTTAAAATAGAACTAAATTCCCCCAAAACACTCTTC

TCATCATTTCAGCCCCCACCCCCAGCCCAGCACTTGAGGCTTCATGCACATCCCTGCTTCTTTTACCTGCCTGACTGCAAGCTCAGCAGATCCTCGGGCA

CAGGCAACCCCCTCCATCTCCTTGCATCCAGGTCCACTTGCTCCATCTCACCCGACACTTGAGACAGCAGGCATTTGATACTGTACTATCTGGAGTTTCC

TCGAGCTTTGCTGTCCTTGAGACATTGCAGTTTGAGCAGACTGAGGTCCAGCCAGGCCAGGGTTACACCAGGGTGTAAAGTGTTCAGTCATATAAGTGGA

TTTTCAGAATTCTTGCTCCAGACTGCCCCCAAGGCTGCACTGAATGTCCCAGCAGCTGGTGAACACTCATGACTGCCTTAACATTCTTCTACTTCGGGTC

TGTCCAGGAGCAAACAGGGTCTGTGAAGATGTCTGAGTCAGGCGACTAGGTAAGTCTCCAGTTAAAAGTCCCATTTCGATTGGAACAAACTGCAGGAAAC

AGCAAGTCCCCAAGATTTCTGAAAGTGTTCACTTCCTTTTCATTTTTAGTGAATGACAAGAACTCAGAAGCACCCCGTGTCCATTAGCCAGATGGTGTAC

ATCTTCTGTAAAATAACTTCCAGTTTAGTTCAGAAGGAAAGTGTGCTGTAGTGCTTATTTAGTGTTGATGTTCAATGTTAGCAACCACTTGAATTGCCAG

AAGTATGCTATGTTAAAGTGGTTGCTAAGGATCATAGCCTTAATTTAAAAAAAAAAATGTAAAAGATAATTCATTCCCCTCCATGTTGAGCTAGTATGGC

TGCATTTCTCAAGAATAAGTCCACAGGCGCCTAGGAAGCATTTCCTCAAAGGAACTTGGTCTTAATTTCTCTTGACCCATCCCTCCCAAGCCCATATGGC

TCCTGTGTCCCAGCCACCTCTTCCATGTTCATAAGTGAGACCAGTTTTTCATGTCTATTTAGTTGTTCTGATGATGCTTTGTCTAGTGTCGGTCGGTCAT

ACCATGACCTGAATTTGAAGACCAGGAGTTTGCATGGTCATATAACCAACATTGCCTTTGCCAGGCCACTGCCACCATCCCTCGATTGCCCCAGGTGGGC

AGGTTGATTCCAGAGACCCTCAGGGAGCCAGAATAACTAGGTACCCATCTGGATTGGCCATGTGGGTGATGAGCACTTATCTCTGGATTTCTTGATTTTG

CAGACTTCAAGGAAGTCCAGGTAGAGGTTGATGGCCAATGACTCCAGCCTTCCCCATGATGGGTTGGTAGGAATCAAATTAGAATTCCTTTGTTTATCAG

GCAACTTTGTTTTAAGGTGGTTTGTTTTTTGATTATGAAAAGGAAGAGGCCACCATGGCCCTTCTGTGAGTTTGTAAGTTTTGAGCAGTGTTTTCATCAC

CAGTCCTGGGAGTCTCTGATCCAATCACCAGTCTGAAGGTGTTTTTTCCTACTTTTGCAAGTAACTAAGTACAGAAGAATAGAGTTCTTAATGTATTCAA

AATAGTAAGTAGATCCCTGAATATAGGCAATAGTAGTTGAAATATTTTCTCAGAAAAACAAAACAACCAGGAAACCCACTCCAGTATTTATAGATCAGAT

TATCAAGGGAAAAAAGTGAATATGCACTCCATATATCTCTAGTTCAGTTACCAAACTTGATCTTATAAAGAAACCTCAGTTGTATGGACAGAATTATCCC

CCTCCCCAATCTTTTTCTGGTGCCATCACCATCTTGAAGGTCTAAGAGCCAGGAAACATTGTAGTCATCTCAGCAGTGTGCAGACAGCTGCCGTCCTGGT

TACCCCAAGCCCACCTTTCAGGGTCGGTGAAACCTTTTGGTGCCCCTCTTCAGGAGCTCCAGACCAAACCCCAGGCCACTCCATGCACCAAAAGCCTTTT

AGAAGGCTTCCCAGTCTGTTAGGATGTCTCAGGAGACATGAGCCATTTCGTGGGGGATGCATGTACTCACAGATGGATGTGTGCACTCTGCTTTGTGGGC

TTTCTTCTCAGAGACAGCACAGCTCCTGCGAACTGATCTCGGTGAGCTGCTCAGACCAGCGAGTAAGCTGGCTCTGAGGCAGAGCAGAGAATGACAGGAA

AGATGAAACCAAAAATGCTATAACTCTCCAATGGAAAGTAATGTTGATGCAGCAATTCCCATTGGATGTATTACACTCTTCTAATTTATTGTTTGTCTCT

TAAGTTTTACCCATTGTACTCTTTAGAAGATGTTAGGATGTTGGTTGCAGGTTTTTTTTTTAAGTAGATGATGTGGGAATCAGTTTTAATTCATGTGTGG

ATGTGTCTAGTTATTGTTAAATGCCCTTTTTTTCTACTTTTTAAAAGATATGTAATATTTCATAATCCCTGGCACTGGTCAAAAAAAAAACACAGCTGTG

AAAAGTAAAATTGTAGTATTTTTTAAATGAATGTCAATTTCAAGTGTATTTGAAATGTTTCCTCCAGTAGACAGATTTGAACACCGTTGGAAAAGACTCC

TTTGCAGAGGAACTAGCCTTTGGAGAAAATGGACTGTGGGTCTGGATATGTTATCTCAGAGTAGCCCATTTCATAGGGCACCGTGACAACACAAATGTGA

TCTTTAAGTATACCTCTTCCCCCTGGGGAGGGAAGGACTTAGTTTGCACCCTTTTTGTATGTAAAATAAAATGTCCTACCTTTCTTGGCTACTTTT
Translation
 - UNI1191 - - UNI30122 -  - UNI18445 - MDHSNREKDDRQRTTKTMAQRNTHCSRPSGTSTSSGVLMVGPNFRVGKKIGCGNFGELRL

G - UNI18445 - GKNLYTNEYVAIKL EPIKSRAPQLHLEYRFYKQLGSAG - UNI8828 - GEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFD

LCDRTFTLKTVLMIAIQL - UNI6436 - LSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYVDPETKKHIPYREHKSLTGTARY

MSINTHLGKE EQSRRDDLEALGHMFMYFLRGSLPWQGLK ADTLKERYQKIGDTKRNTPIEALCENFPE EEMATYLRYVRRLDFFEKPDYEYLRTLFT

DLFERKGYTFDYAYDWVGRPI PTPVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQ - UNI3335 - VVSSTNGELNVDDPTGAHSNAPITAHAEV

EVVEEAN NCLKMLNLW WCCCFFKRKRKKTAQRHK
Transcript ENSMUST00000034949
Sequence
TGGTCTTCCCCCTCCCCTCCGCCTCCTCCGCTCCCTCCGCTCCCTCCCGCTCCTGGGAAAGCAAAGCTGCGGCTTAAGGGGTGGTTGAGAGAAGCAGTAG

GCGCCTCGGGGAGGGGACCGCGCCCGCCCCCTTGGAACACTGGAGCACCGCTGATTTAG - UNI1191 - - UNI30122 - GAGGACAGGTGTGAG

GCCAGTGCACCTTTGACCCAATGGGGCTTAACTG - UNI18445 - GTTACAAAATGTCCTTCTATGCATGAGATCTACGGACTATATGTTCTTCAAG

AACTGATCAGTGGTTTTCACCTTCTGGAAGAACACTAGAAGCATAAATATGGTGCCAAAACTCCTCATTCTCTGACTGTGGTGATTTGGACATACTTCTG

TGTGGAGGAGAAGTATACACGCTGAGGTCACTCATTGTTCAGAGACTGTCGTGTAGGAACATGGACCATTCTAATAGGGAAAAGGATGATAGACAACGGA

CAACTAAAACCATGGCACAAAGGAATACACACTGTTCGAGACCATCTGGCACTTCAACATCCTCTGGGGTTCTCATGGTGGGACCCAACTTCAGGGTTGG

CAAGAAGATAGGGTGTGGGAACTTCGGAGAGCTCAGATTAG - UNI18445 - GTAAAAATCTCTACACCAATGAATATGTAGCCATTAAACTG GAA

CCAATAAAATCACGTGCTCCACAACTTCATTTAGAGTACAGGTTTTATAAACAGCTTGGCAGTGCAG - UNI8828 - GTGAAGGCCTCCCACAGGTT

TATTACTTTGGACCATGTGGGAAGTACAATGCCATGGTGCTGGAACTCCTTGGCCCTAGCTTGGAAGACTTGTTTGACCTCTGTGACCGAACGTTTACTT

TGAAGACGGTGTTAATGATAGCCATCCAGTTG - UNI6436 - CTTTCTCGAATGGAGTATGTACACTCAAAGAATCTTATTTACCGAGATGTCAAAC

CAGAGAACTTCTTGATTGGCCGACAAGGCAATAAGAAAGAGCATGTAATACACATTATAGATTTTGGACTGGCCAAGGAATATGTTGATCCTGAAACCAA

AAAACACATACCTTACAGAGAGCACAAAAGTTTGACTGGAACTGCGAGATACATGTCTATCAACACACATCTAGGCAAAG AGCAAAGCCGGCGAGATGA

TTTGGAAGCCTTAGGCCATATGTTCATGTACTTCCTCCGAGGCAGCCTACCCTGGCAAGGACTCAAG GCTGATACATTAAAAGAGAGATATCAAAAAAT

CGGTGATACCAAAAGGAATACTCCCATCGAAGCTCTCTGTGAGAACTTTCCAG AGGAGATGGCAACCTACCTTCGATATGTCAGGCGATTAGACTTCTT

TGAAAAACCTGATTATGAGTATTTACGGACCCTCTTCACAGATCTGTTTGAACGGAAAGGCTATACCTTTGACTATGCCTATGATTGGGTTGGAAGGCCT

ATT CCTACTCCAGTAGGATCAGTTCATGTAGATTCTGGTGCATCTGCAATAACTCGAGAAAGCCACACACACAGGGATCGGCCATCACAACAACAGCCT

CTTAGAAATCAG ACTACATCATCAGAGCGCCGAGGAGAGTGGGAAATCCAGCCCAGCCGGCAGACCAATACCTCATACCTGACGTCTCACTTGGCCGCA

GACCGCCATGGGGGTTCAGTACAG - UNI3335 - GTGGTTAGCTCAACCAATGGAGAGCTGAATGTCGATGACCCCACTGGAGCTCACTCCAATGCA

CCAATCACAGCTCATGCCGAAGTGGAGGTAGTGGAGGAAGCTAA GTGCTGCTGTTTCTTTAAGAGGAAAAGGAAGAAGACAGCCCAGCGACACAAGTGA

CCAGTGCCTCCCAGGAGTCCTCAAGTCCTGGGGACTCTGGCTCCAATTGCACCTGCAGCTCCTGCCATTTCTCATTGGAAGGGACTCCTCTGTGGGGGAG

GGTAGAGATCCAAACCAAAAAGAAGAAAACAGATGCCCCCAGAAGGAGCCAGTGCAGGCAGCCAGGGCCGAGTGGGCCAGTGGCAATCCCCTCTGTCTGA

GCTCTGAGCGGGTCCAGAGCTGCTGCTTCTCCACTGCTTGCCCTTGGGCTATCTGGTTGACTCTCTTCCCATTGTTTACAGTGAAGGTGTCATTCACAAA

AACTCAAGGACTACTATTCTCTTCCCCCCTTTTTACTCCTGGCTCTTGCACCATCCTCAACCCTCTCCAGCATAAAGAAACTACTAAGCTAAAGGCTCTA

TCAAGAAGCTGGTGGTGTGGCCAAGAAGATAGGGGAAGATGACAGCCCTGGGCTGGAGAACTTCTCCACTTCCCAGGTGTGTCTGGTAGTGTGGCTTCCT

CTCCCTCTGTGCCTGGGTAACCCCTCAGCCCAGCTGGCCACAGGGTTCAGGTCCCTTCCTTTGTCCTTCCCTTCCTCCCTCCCTCCTTCCCTCCTGTGAA

GTTACACTGTAGGACACAAGCTGTGAGCAGTCTGCAGTCTACTGTCCCTGTGTGTTGGCGTTCTTAGCTTTTTTGACAAGCAGATCCCTTGCTCCGGGCT

GTAGCAAAATATGCCTGTGGTTCTGAGCAAAGGAAAGGAAACTGACTTTATTGCACTTTTAGTTTTTTGGGTTTTTGTTTTTATTTTATAAACAACATGG

CAGATGCATATTGTGTCTGGTTATATTGGGGGGTTTGTTTTTTTTTTTTTTTTCTTTTTCAAGGGGGATGGGCCAGCCAAGCCATTCAGAGAAAATGTGG

GTCCAGAGGACATTTTTGATGGAAAGAGTCTGATTTGCAGCACTTGGAAGAGAAGAAGCCAAACTCTGCGTCATCCTGAGTAATATTCAGGTTGGCAAGG

AAACATACTTGAATTTTCATTCATCTTCTCTGCTGCAGAAAAAAGTCCAGAGCCCTGACCTAATCAATCAGCCCAGACCTAATCAATCAGCCCAGAGCTT

GAGCCCAGCTCCTGAGCCCGTGGGATGAGCACCGAGCCAGACTGTGACCAACCAGAAGGCACCTCGTCTCAGAGAGGAGATACTGAACAACAACAACAAA

GCAAATTTCTGTTTCCTCCACTGCCAGGGACTTCCTACTAGATAGCCATGTGACTTTCTGTTGACTCGGGGGACAAAATTAGTGACTAAACACCCACCAC

CGTATTGCCAGTAGTGGACAAAAGAAGGCACCACATTTGCCTTCCAACTGCCAGAGGAGTCTCAGGATGCAGCATCCTAGGGCCAGGAAAAGAAAATATT

TTCTGTCTGCCTGAAGTGAGCTAGAACATGTGGGTCAGTCTGCCTTAGAAACCATGCCTGTGATAATTTTGGAGCATATCCATAGCAACAGGCTTAGAAC

GTGGTACATGGGGCTGCTGCAAGCAGAGAAGGTAAGATTGGTTGGTGCTAGGAAATTCCAGGGAAAAGGAAACTGTAATGAAAGGTCTAAAATTTTATCT

AAACAATCGAACAGAGACTGTCCAGACAGTATGACCACATATCTTAGCATGTTTTCCCCGGTACACACTCTATCTGCTACGGTGAAGCATCACTGGTTGC

ACAGTTAACAGTGTGTGGGGTTACTCCTCCCATGTTCTATTTTATTTGAGATTAGTGGCATTTCCAGATAGTAACTTCTTATGCTAGTTGTGGCAAAAAG

GCTTATTCACGTGGGTAAAGAGGTCTTGTGTTTGGGTATAAAGAACTAACCACCGAGAGCAGTGGCTAGTGACTTAGTACAGCACAGAACTCTTTGCTTT

TATATGTAGAGGACTGGACTGGAAGATGTCAGGACACTTGTGGTCATGGATCAAATTTAGTATCAAATGAAGCAGAGTTTGTGCACCTTACCTGTTCTAT

TGGACTGTGGCTAGGGAATCTCCTCACTGACTTCAAACCTGGTTAGCATTTGTAAATATTGCCACCTGGCCATTTCTTTACAAGAAATGTTTTTGTCTGT

GAATCAGAGTGGCAGGGAGAAGTCAGGTCAGACCCCTTCCCCATAAGGAGTTGGAGTGTTAGGATTTGCTTCCTTTTTACTATATAGTAGTTAAAGCTCA

TCACTAACATTTATACAGTCCCTCATTTGGCATGTGGGCAACTCTGACTTCCCCTACAGAAACTTAAAAGTCTTTATCCCAGGAAATGGTGGCAACCTGG

CACTCTCTGCCCTACTAAGTGCCTCCCCCACCCTGCTTCCAAGGTAAAGTAAAGGCAGTGACCAGCTTGGCTGCAGGGTGGGATGCCCTGCAGCTGGGCT

TAAGACTTCTTTTTTGTCTTAAAATATTTTTATAGGCTAGCTCTTGAGGGGTTAAACCTGAGTGGTTTGTGTATGTGGGGGAGTGTCCTTCCTAATGCAC

TGTTGGCACCCTCCAGCACCCACAAATCCCTTACTAGGTATTTGGGTTTTGTAGCAAAGGTCCCTTTAACGTGCAGGGTGGTGGTGATCCTTTCAAGGCC

AGTGACACGCCAAGGTGATCCCAAACCTGAGGAATTCTCATCTTCCTTAAAGTTAAAATAGAACTAAATTCCCCCAAAACACTCTTCTCATCATTTCAGC

CCCCACCCCCAGCCCAGCACTTGAGGCTTCATGCACATCCCTGCTTCTTTTACCTGCCTGACTGCAAGCTCAGCAGATCCTCGGGCACAGGCAACCCCCT

CCATCTCCTTGCATCCAGGTCCACTTGCTCCATCTCACCCGACACTTGAGACAGCAGGCATTTGATACTGTACTATCTGGAGTTTCCTCGAGCTTTGCTG

TCCTTGAGACATTGCAGTTTGAGCAGACTGAGGTCCAGCCAGGCCAGGGTTACACCAGGGTGTAAAGTGTTCAGTCATATAAGTGGATTTTCAGAATTCT

TGCTCCAGACTGCCCCCAAGGCTGCACTGAATGTCCCAGCAGCTGGTGAACACTCATGACTGCCTTAACATTCTTCTACTTCGGGTCTGTCCAGGAGCAA

ACAGGGTCTGTGAAGATGTCTGAGTCAGGCGACTAGGTAAGTCTCCAGTTAAAAGTCCCATTTCGATTGGAACAAACTGCAGGAAACAGCAAGTCCCCAA

GATTTCTGAAAGTGTTCACTTCCTTTTCATTTTTAGTGAATGACAAGAACTCAGAAGCACCCCGTGTCCATTAGCCAGATGGTGTACATCTTCTGTAAAA

TAACTTCCAGTTTAGTTCAGAAGGAAAGTGTGCTGTAGTGCTTATTTAGTGTTGATGTTCAATGTTAGCAACCACTTGAATTGCCAGAAGTATGCTATGT

TAAAGTGGTTGCTAAGGATCATAGCCTTAATTTAAAAAAAAAAATGTAAAAGATAATTCATTCCCCTCCATGTTGAGCTAGTATGGCTGCATTTCTCAAG

AATAAGTCCACAGGCGCCTAGGAAGCATTTCCTCAAAGGAACTTGGTCTTAATTTCTCTTGACCCATCCCTCCCAAGCCCATATGGCTCCTGTGTCCCAG

CCACCTCTTCCATGTTCATAAGTGAGACCAGTTTTTCATGTCTATTTAGTTGTTCTGATGATGCTTTGTCTAGTGTCGGTCGGTCATACCATGACCTGAA

TTTGAAGACCAGGAGTTTGCATGGTCATATAACCAACATTGCCTTTGCCAGGCCACTGCCACCATCCCTCGATTGCCCCAGGTGGGCAGGTTGATTCCAG

AGACCCTCAGGGAGCCAGAATAACTAGGTACCCATCTGGATTGGCCATGTGGGTGATGAGCACTTATCTCTGGATTTCTTGATTTTGCAGACTTCAAGGA

AGTCCAGGTAGAGGTTGATGGCCAATGACTCCAGCCTTCCCCATGATGGGTTGGTAGGAATCAAATTAGAATTCCTTTGTTTATCAGGCAACTTTGTTTT

AAGGTGGTTTGTTTTTTGATTATGAAAAGGAAGAGGCCACCATGGCCCTTCTGTGAGTTTGTAAGTTTTGAGCAGTGTTTTCATCACCAGTCCTGGGAGT

CTCTGATCCAATCACCAGTCTGAAGGTGTTTTTTCCTACTTTTGCAAGTAACTAAGTACAGAAGAATAGAGTTCTTAATGTATTCAAAATAGTAAGTAGA

TCCCTGAATATAGGCAATAGTAGTTGAAATATTTTCTCAGAAAAACAAAACAACCAGGAAACCCACTCCAGTATTTATAGATCAGATTATCAAGGGAAAA

AAGTGAATATGCACTCCATATATCTCTAGTTCAGTTACCAAACTTGATCTTATAAAGAAACCTCAGTTGTATGGACAGAATTATCCCCCTCCCCAATCTT

TTTCTGGTGCCATCACCATCTTGAAGGTCTAAGAGCCAGGAAACATTGTAGTCATCTCAGCAGTGTGCAGACAGCTGCCGTCCTGGTTACCCCAAGCCCA

CCTTTCAGGGTCGGTGAAACCTTTTGGTGCCCCTCTTCAGGAGCTCCAGACCAAACCCCAGGCCACTCCATGCACCAAAAGCCTTTTAGAAGGCTTCCCA

GTCTGTTAGGATGTCTCAGGAGACATGAGCCATTTCGTGGGGGATGCATGTACTCACAGATGGATGTGTGCACTCTGCTTTGTGGGCTTTCTTCTCAGAG

ACAGCACAGCTCCTGCGAACTGATCTCGGTGAGCTGCTCAGACCAGCGAGTAAGCTGGCTCTGAGGCAGAGCAGAGAATGACAGGAAAGATGAAACCAAA

AATGCTATAACTCTCCAATGGAAAGTAATGTTGATGCAGCAATTCCCATTGGATGTATTACACTCTTCTAATTTATTGTTTGTCTCTTAAGTTTTACCCA

TTGTACTCTTTAGAAGATGTTAGGATGTTGGTTGCAGGTTTTTTTTTTAAGTAGATGATGTGGGAATCAGTTTTAATTCATGTGTGGATGTGTCTAGTTA

TTGTTAAATGCCCTTTTTTTCTACTTTTTAAAAGATATGTAATATTTCATAATCCCTGGCACTGGTCAAAAAAAAAACACAGCTGTGAAAAGTAAAATTG

TAGTATTTTTTAAATGAATGTCAATTTCAAGTGTATTTGAAATGTTTCCTCCAGTAGACAGATTTGAACACCGTTGGAAAAGACTCCTTTGCAGAGGAAC

TAGCCTTTGGAGAAAATGGACTGTGGGTCTGGATATGTTATCTCAGAGTAGCCCATTTCATAGGGCACCGTGACAACACAAATGTGATCTTTAAGTATAC

CTCTTCCCCCTGGGGAGGGAAGGACTTAGTTTGCACCCTTTTTGTATGTAAAATAAAATGTCCTACCTTTCTTGGCTACTTTT
Translation
 - UNI1191 - - UNI30122 -  - UNI18445 - MDHSNREKDDRQRTTKTMAQRNTHCSRPSGTSTSSGVLMVGPNFRVGKKIGCGNFGELRL

G - UNI18445 - GKNLYTNEYVAIKL EPIKSRAPQLHLEYRFYKQLGSAG - UNI8828 - GEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFD

LCDRTFTLKTVLMIAIQL - UNI6436 - LSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYVDPETKKHIPYREHKSLTGTARY

MSINTHLGKE EQSRRDDLEALGHMFMYFLRGSLPWQGLK ADTLKERYQKIGDTKRNTPIEALCENFPE EEMATYLRYVRRLDFFEKPDYEYLRTLFT

DLFERKGYTFDYAYDWVGRPI PTPVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQ TTSSERRGEWEIQPSRQTNTSYLTSHLAADRHGGSVQ - U

NI3335 - VVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEAK KCCCFFKRKRKKTAQRHK

For any suggestions or comments, please send an email to unitrap@crg.es