Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032386 (Trip4)
Chromosomal location
Chr 9: 65678943 - 65756593 (-)
Description
thyroid hormone receptor interactor 4 Gene [Source:MGI (curated);Acc:Trip4-001]
RefSeq_dna
NM_019797 
RefSeq_peptide
NP_062771.2 
UniGene
Mm.208379 Mm.400931 Mm.413018 
MGI
MGI:1928469 
Uniprot/SWISSPROT
Q9QXN3 
Uniprot/SPTREMBL
Q3UBZ2 Q3UJV0 
Human Ortholog
ENSG00000103671 (TRIP4)
Omim not available
UniTrap UNI20655
Vector Insertion
Chr 9: 65746183 - 65746335
Public Clones not available
Private Clones OST355604 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30779
Vector Insertion
Chr 9: 65732734 - 65744738
Public Clones IST13403H1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26799
Vector Insertion
Chr 9: 65732734 - 65732981
Public Clones not available
Private Clones OST96833 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26065
Vector Insertion
Chr 9: 65732734 - 65732864
Public Clones not available
Private Clones OST141892 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19125
Vector Insertion
Chr 9: 65728868 - 65732734
Public Clones IST12248H11 (tigm)
Private Clones OST404040 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9268
Vector Insertion
Chr 9: 65727016 - 65728697
Public Clones XG429 (baygenomics) IST14759F3 (tigm)
Private Clones OST301663 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4232
Vector Insertion
Chr 9: 65720985 - 65722637
Public Clones AK0713 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37899
Vector Insertion
Chr 9: 65706052 - 65712227
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12257
Vector Insertion
Chr 9: 65699266 - 65700632
Public Clones A051B04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7175
Vector Insertion
Chr 9: 65686845 - 65699173
Public Clones RRU453 (baygenomics) RRN072 (baygenomics) RRI275 (baygenomics) IST13764E9 (tigm)
IST11968H6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28671
Vector Insertion
Chr 9: 65681256 - 65686741
Public Clones CMHD-GT_427E12-3 (cmhd)
Private Clones OST24006 (lexicon)
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000122410
Sequence
CAGCCCAGCTGGTTCCGGCTGGGGAAGATGGCGGTGGCTGGGGCGGCGTACCGGGAGCCGCTAGTACACTGGTGCACACAGCAGTTGCAAAAAACTTTCG

CCCTGGATGTCAGCGAGGAAATCATACA - UNI19125 - - UNI26065 - - UNI26799 - - UNI30779 - ATATGTTTTGTCAATTGAG

AATGCTGAAGAAATACGAGAATATGTGACAGACCTTCTCCAGGGAAATGAGGGCAAAAAGGGTCAATTCATAGAAGATCTTATAACCAAATGGCAAAAGA

ATGATCAAGAGTTCATCTCTGATTCCTTTCAACAGTGCTTGAGAAAAGATG - UNI9268 - AAATTTTAGATGGACAGAGATCAGTGGACCAGCTAA

AGCGGAGTAGGAGGAAAGGACGAAACAAACAGGAAGTTCCTGCATTTCCTGAACCTGACGTAGCTGTGGAGGTCAAAACACCTTTAGATTTGGCTAAG G

CACAAGAAAGCAACAACTCCGTAAAGAAGAAGACAAGATTTGTCAATTTATATACAAGAGAGGGACAGGACAAACTTGCAGTCCTGCTTCCTGGTCGTCA

CCCGTGTGATTGCCTGGGCCAGAAGCACAAACTCATCAATAACTGTCTGGTCTGTGGGCGGATCGTTTGTGAGCAGGAGGGTTCAGGCCCCTGCTTGTTC

TGTGGCTCTTTG - UNI4232 - GTGTGTACTAATGAAGAACAGGATATTTTACAGCGGGACTCAAACAAAAGTCAGAAACTGCTGAAGAAGCTCATG

TCAG GGGCAGAGACTTCTGGAAAGGTGGACGTCTCTACCAAGGACCTACTTCCTCATCAAGAATCCCGAATGAAGTCTGGTTTGGAGAAGGCTATCAAG

CATAAGGAAAAACTGTTAGAGTTCGACAGAACGAG TATCCGAAGGACCCAAGTTATTGACGATGAATCAGATTACTTTGCCAGTGATTCTAACCAGTGG

CTGTCCAAAGTTGAGCGAGAAATGCTGCAGAAACGAGAGGAGGAGCTGAGAGAACTCCGACATGCCTCCAGACTTTCTAAGAAAGTGACCATTGACTTCG

CGGGGCGGAAGATCCTAGAAGATGAAAATCCACTAGCAGAGTATCACAGCAG ACTAGATGAGACAATACAAGCCATTGCCAGTGGGACTTTGAACCAGT

CACTGGTCACGTTGGATAGATCTTGTGAAGAGCCTTTGGGAGTTCTGGTAAACCCTAACATGTACCAGGCCTCTCCTCAG TGGGTTGACAACACTGGCT

CAACCCCACAGAAGAAGACTTCACTCTCGGCAGGACCAAGACTAGAGCCCAGTTTACATCAGCACCAGCTGCGAATCCAGGACCAAGAATTCCAGGAAGG

CTTTGATGGCGGCTGGTGCCTGTCTATGCATCAGCCCTGGGCTTCTCTGCTTGTCAGGGGGATTAAAAG GGTGGAGGGCAGATCCTGGTATACTCCTCA

CAGAGGAAGACTTTGGATAGCAGCCACGGGCAAAAGACCTTCCCCTCAGGAAGTCTCAGAACTCCAGGCTACCTATCGTCTTCTTCGTGGGAAAG - UN

I12257 - ATGTGGAGTTTCCAAATGACTATCCGTCGGGTTGTCTTCTGGGCTGTGTGGACCTTATTGATTGCTTGTCCCAGAAACAATTTCAGGAGCA

G - UNI7175 - - UNI28671 - GGAAACTGGATTCCAAGATCCATCAAGGAGCAAAGAAGGGGTTAATGAAGCAGAATAAAGCTGTCTGACCCAG

GAAAAAAGGAACTATACAACATAGTGGAGTCTTGTGTACTAAAGTGCTATCCGCTGGGCCTTTGGGATTGAAGCAGTAGAAAGCGAAAAGGCTGGGCACC

AGGCTTCAATCTCTGAGAATCTAAACTCTTACCAAATCTGTGTATTTTTCTTAAAGGATGGAATTCTTTATGAAGTGGGTTACAGATCTTTGAATATGTT

ATTTATAAAAAAATCATTTTAAAAATTCTAGGTCATTTTTCTCAGAACTAAATTCAAAACAGGAAGGAACAAATTGGAAATTATTTTCCTCAGTGAGATT

TGTATTTTGAATTAGGAAAATCTCAACATAGATTAACATTTTTACAAGAGACTCTGAATTTAATTTTTTTTCTCAAAATAATAGAATGGAGACTACTAGG

ATGTCTGAGGAATCTTTGTTTAACATAAGCCTATGGTGAAATGAGAATGTTCTTACCAAGTGTTCTGCTTTTGACATCTTGAGACCAGGCCACATTCTGT

GACCCAGGCTTGCCTGGAACTCACAACAATCCTCCTGCCGAAGCCTCTCAAGTGCTGTGTTTACAGGCCAGTAGCCCCATGCTCAGCTTCTAACCCAAAT

CTCTCAGAGTGGAAAGCTAGAATTCCCAGTATCAGCAGATTTTTTTTTCTTTCTTTTTGGAAAAGGTAACATGAAGACATACTTCCTTTTGTTCTTTAGT

TTGAGAACATGGGTTAGTCTGGGAAGTGAGGGAGCTACCTGCTAATGCAGCCTGAAGCTGCCCTGTTTATTTTGTTAGTGTTGCAAAAGCATCATGTAGA

TGGGACAATTAGAGAAAAACTTGAAAATACGATCCTTTGGTAAATACATCAGAAAGCCCTCTAATGCTGAAAACAAGCCCCTTTAAACCTATAAATATCC

TAAAAAAGCCATTACTGGAAAAATAAGGTTGGTTTGAAGTGAGATTTTTCACTGGTCCCTTTAGCCCTTCTCAGGAAGCACTTGTTTCTGAGGCTCTTCT

AAAGTGCTATTGGAATCTCAGTTGCTGGAGCCTAGGAAATTCATGGTCTCAAATGTGTGTGCTCTGCTTTTTATAAAACACCACTACCACACTAGGGATG

TTGGACTCCCTCCAACAGTTTGTGTGCTTGACTTAAAAAAGAAAGAGCAAGTGAGAAAGAAAAAAAAGTACCTTGTGTTATGAAAAAGATTAATTTCCCT

TTCTTTAATCCTTCATATTCAGCATTTATTTGCATTGAAATGCCTCCACTCATTCCACATTGATGTTCACTCGACTGTGAACTGCCTGTTGCATAGCATT

GGTTCTTCGGAGGCTGATCACTCTGGATTCCCAGGGAAACCCGAACAGATTCTTGTTCCAGTGATGTACACATGCAGTATTCTCTCTCGTGTTCTGTTGG

ACCTCTGTGTATAAAGTGGAAGAGGACAGTTAGTGGCATTTATTATTGTGAGAGATGTCTTTTTGACCTCTTGGAAACCTTACCATTGTTGAAAGCAAAA

CTGTGTTTACTATGTAGTTAATAGTTTACCAAGTAGTAGCACCTTGAATTCCATGCTGAAATTGTCTGGCTTTCTTAATATCACAATAAAATTGAAAGGT

AGGATGGGAAGAGAAAAGAAGGGGTTGGAAGTTCTCTGTTCTTTTATTTGAAGACAGCCTTTACACAGAAGAGTATGGATTGTTTTTTCTATGTGGGTAA

TTTGAATGCACACCTTAAAAGAAAAAAGTCAGGAATGTCAACAGATGAGCTCATCTGCCCGAGCTTTGCAAGTTTCTAAGAACCCACCTCAGCTTCTCAA

ACACACAGCCAGAACCACATAAATAAATGGCAGAGCTACTCGGAAACTTCTCCTTTTCATGGTTAGGCTGGGAAAGTCTGTCTTTGGTTTACATGGCAGT

GGTAGTATAAGGTCTCTCTTCTGTTTGCTGAGACACAAGGGAGGAAGTGTGGGAGAAGTTTGCGGGTAGATGGCCCTCAGTTGCTCACTGATGAATAGTA

TACTTTAAAGTCAGATGGAAATTCTTAGTAGCCTGAGTTCAAGCTTGTCCAAGAATAGCTTGTTAGTGTATTATGACACTTCACTCTGACCCTGTTACTC

TGGGGCAGTTTCGCCTAAGAAAGTTCTGAATTTCCGAGATGCCTTTTTGTTGTAGCTTCTGTGTTCCCTTTTGAATGACTGAATTAAGATGCCATTAATT

CATACAGTAAAGGAATTGGCTTTTTCTTTTTGTTTTTCCC
Translation
MAVAGAAYREPLVHWCTQQLQKTFALDVSEEIIQ - UNI19125 - - UNI26065 - - UNI26799 - - UNI30779 - QYVLSIENAEEIR

EYVTDLLQGNEGKKGQFIEDLITKWQKNDQEFISDSFQQCLRKDE - UNI9268 - EILDGQRSVDQLKRSRRKGRNKQEVPAFPEPDVAVEVKTPLD

LAK AQESNNSVKKKTRFVNLYTREGQDKLAVLLPGRHPCDCLGQKHKLINNCLVCGRIVCEQEGSGPCLFCGSL - UNI4232 - VCTNEEQDILQR

DSNKSQKLLKKLMSG GAETSGKVDVSTKDLLPHQESRMKSGLEKAIKHKEKLLEFDRTS SIRRTQVIDDESDYFASDSNQWLSKVEREMLQKREEELR

ELRHASRLSKKVTIDFAGRKILEDENPLAEYHSR RLDETIQAIASGTLNQSLVTLDRSCEEPLGVLVNPNMYQASPQ WVDNTGSTPQKKTSLSAGPRL

EPSLHQHQLRIQDQEFQEGFDGGWCLSMHQPWASLLVRGIKR RVEGRSWYTPHRGRLWIAATGKRPSPQEVSELQATYRLLRGKD - UNI12257 - 

DVEFPNDYPSGCLLGCVDLIDCLSQKQFQEQ - UNI7175 - - UNI28671 - GNWIPRSIKEQRRG
Transcript ENSMUST00000113774
Sequence
GGGGACTGTTGGTAAGTGGGTTGGGAGCTTCGTTTTCTCATTTGGAAATGTTTTTAGGCCTTTAGTTTACAATGTTAGGCCAGGTAAACCCTTCGCTGCA

GCAGGTAGTAGGCCCAACGTAGCTGCTTCCATCAGTTGGTCTCTGACACCAGCTCCAAACTACACACACCTCCTGGAATCCTGGGCCATCTCGGCAGCTC

CTCCCAAAGCTCCTCTCCAGGCCCCTTGCGGGAGCTTCTTTCTCACTGTCTAGCAAGCATCTCCCTCTGGTGGATTTCCTGTCGTTTCAACCAGACTTTT

GCATGCATTTCGTTCTGAACCGGCTCCAGAAGTCGAACAGTGAAGTGG - UNI20655 - ACACTGGACCCAGGGACATATGCTAGACAGGTACTCCA

CCAAGGAGCTACAAACACATCTCTGGTTGTGGTTTTTTTGAGACTATCTCACCATGCACTCCAGGCTGGCTTTAAACTCATGGATCTCCCTGTCTCAATC

TTTGTAATTAAAG - UNI20655 - - UNI30779 - TGAAACTCCAGGAGGCTTAAGATTAATATTCACCGTCTAATTAACCCTTGAGATGATCTT

CAAGGCAGTCGTCCAGTTTGAGCTTCTCAAGGTTTTCTGAGTTACTAAAACCAGTGGGCTGAGTAGATTTGAAGACCTGGTTTTGTTTGCCTTGCAACAC

TGGATGGGCAGGTGCCACTTGGTCCAATATTAGTGTGGTCTGGCCTGAGTCTCTAATGGATAAGGCACAGAAAG - UNI26799 - - UNI30779 -

 ATCCGGAAGCTGAGCGAAGCCTGCGCGACCGAGCGGGGCGGTGCAAGCTTGCGGAACCTTCATCGACGAGGTCGGCGCTGCGAAGGGAACCAGTCCAGG

GCGGGACGAGAGGCTTTTGCAGCCCAGCTGGTTCCGGCTGGGGAAGATGGCGGTGGCTGGGGCGGCGTACCGGGAGCCGCTAGTACACTGGTGCACACAG

CAGTTGCAAAAAACTTTCGCCCTGGATGTCAGCGAGGAAATCATACA - UNI19125 - - UNI26065 - - UNI26799 - - UNI30779 - 

ATATGTTTTGTCAATTGAGAATGCTGAAGAAATACGAGAATATGTGACAGACCTTCTCCAGGGAAATGAGGGCAAAAAGGGTCAATTCATAGAAGATCTT

ATAACCAAATGGCAAAAGAATGATCAAGAGTTCATCTCTGATTCCTTTCAACAGTGCTTGAGAAAAGATG - UNI9268 - AAATTTTAGATGGACAG

AGATCAGTGGACCAGCTAAAGCGGAGTAGGAGGAAAGGACGAAACAAACAGGAAGTTCCTGCATTTCCTGAACCTGACGTAGCTGTGGAGGTCAAAACAC

CTTTAGATTTGGCTAAG GCACAAGAAAGCAACAACTCCGTAAAGAAGAAGACAAGATTTGTCAATTTATATACAAGAGAGGGACAGGACAAACTTGCAG

TCCTGCTTCCTGGTCGTCACCCGTGTGATTGCCTGGGCCAGAAGCACAAACTCATCAATAACTGTCTGGTCTGTGGGCGGATCGTTTGTGAGCAGGAGGG

TTCAGGCCCCTGCTTGTTCTGTGGCTCTTTG - UNI4232 - GTGTGTACTAATGAAGAACAGGATATTTTACAGCGGGACTCAAACAAAAGTCAGAA

ACTGCTGAAGAAGCTCATGTCAG GGGCAGAGACTTCTGGAAAGGTGGACGTCTCTACCAAGGACCTACTTCCTCATCAAGAATCCCGAATGAAGTCTGG

TTTGGAGAAGGCTATCAAGCATAAGGAAAAACTGTTAGAGTTCGACAGAACGAG TATCCGAAGGACCCAAGTTATTGACGATGAATCAGATTACTTTGC

CAGTGATTCTAACCAGTGGCTGTCCAAAGTTGAGCGAGAAATGCTGCAGAAACGAGAGGAGGAGCTGAGAGAACTCCGACATGCCTCCAGACTTTCTAAG

AAAGTGACCATTGACTTCGCGGGGCGGAAGATCCTAGAAGATGAAAATCCACTAGCAGAGTATCACAGCAG ACTAGATGAGACAATACAAGCCATTGCC

AGTGGGACTTTGAACCAGTCACTGGTCACGTTGGATAGATCTTGTGAAGAGCCTTTGGGAGTTCTGGTAAACCCTAACATGTACCAGGCCTCTCCTCAG 

TGGGTTGACAACACTGGCTCAACCCCACAGAAGAAGACTTCACTCTCGGCAGGACCAAGACTAGAGCCCAGTTTACATCAGCACCAGCTGCGAATCCAGG

ACCAAGAATTCCAGGAAGGCTTTGATGGCGGCTGGTGCCTGTCTATGCATCAGCCCTGGGCTTCTCTGCTTGTCAGGGGGATTAAAAG GGTGGAGGGCA

GATCCTGGTATACTCCTCACAGAGGAAGACTTTGGATAGCAGCCACGGGCAAAAGACCTTCCCCTCAGGAAGTCTCAGAACTCCAGGCTACCTATCGTCT

TCTTCGTGGGAAAG - UNI12257 - ATGTGGAGTTTCCAAATGACTATCCGTCGGGTTGTCTTCTGGGCTGTGTGGACCTTATTGATTGCTTGTCCC

AGAAACAATTTCAGGAGCAG - UNI7175 - - UNI28671 - GGAAACTGGATTCCAAGATCCATCAAGGAGCAAAGAAGGGGTTAATGAAGCAGA

ATAAAGCTGTCTGACCCAGGAAAAAAGGAACTATACAACATAGTGGAGTCTTGTGTACTAAAGTGCTATCCGCTGGGCCTTTGGGATTGAAGCAGTAGAA

AGCGAAAAGGCTGGGCACCAGGCTTCAATCTCTGAGAATCTAAACTCTTACCAAATCTGTGTATTTTTCTTAAAGGATGGAATTCTTTATGAAGTGGGTT

ACAGATCTTTGAATATGTTATTTATAAAAAAATCATTTTAAAAATTCTAGGTCATTTTTCTCAGAACTAAATTCAAAACAGGAAGGAACAAATTGGAAAT

TATTTTCCTCAGTGAGATTTGTATTTTGAATTAGGAAAATCTCAACATAGATTAACATTTTTACAAGAGACTCTGAATTTAATTTTTTTTCTCAAAATAA

TAGAATGGAGACTACTAGGATGTCTGAGGAATCTTTGTTTAACATAAGCCTATGGTGAAATGAGAATGTTCTTACCAAGTGTTCTGCTTTTGACATCTTG

AGACCAGGCCACATTCTGTGACCCAGGCTTGCCTGGAACTCACAACAATCCTCCTGCCGAAGCCTCTCAAGTGCTGTGTTTACAGGCCAGTAGCCCCATG

CTCAGCTTCTAACCCAAATCTCTCAGAGTGGAAAGCTAGAATTCCCAGTATCAGCAGATTTTTTTTTCTTTCTTTTTGGAAAAGGTAACATGAAGACATA

CTTCCTTTTGTTCTTTAGTTTGAGAACATGGGTTAGTCTGGGAAGTGAGGGAGCTACCTGCTAATGCAGCCTGAAGCTGCCCTGTTTATTTTGTTAGTGT

TGCAAAAGCATCATGTAGATGGGACAATTAGAGAAAAACTTGAAAATACGATCCTTTGGTAAATACATCAGAAAGCCCTCTAATGCTGAAAACAAGCCCC

TTTAAACCTATAAATATCCTAAAAAAGCCATTACTGGAAAAATAAGGTTGGTTTGAAGTGAGATTTTTCACTGGTCCCTTTAGCCCTTCTCAGGAAGCAC

TTGTTTCTGAGGCTCTTCTAAAGTGCTATTGGAATCTCAGTTGCTGGAGCCTAGGAAATTCATGGTCTCAAATGTGTGTGCTCTGCTTTTTATAAAACAC

CACTACCACACTAGGGATGTTGGACTCCCTCCAACAGTTTGTGTGCTTGACTTAAAAAAGAAAGAGCAAG
Translation
 - UNI20655 -  - UNI20655 - - UNI30779 -  - UNI26799 - - UNI30779 - MAVAGAAYREPLVHWCTQQLQKTFALDVSEEI

IQ - UNI19125 - - UNI26065 - - UNI26799 - - UNI30779 - QYVLSIENAEEIREYVTDLLQGNEGKKGQFIEDLITKWQKNDQEF

ISDSFQQCLRKDE - UNI9268 - EILDGQRSVDQLKRSRRKGRNKQEVPAFPEPDVAVEVKTPLDLAK AQESNNSVKKKTRFVNLYTREGQDKLAV

LLPGRHPCDCLGQKHKLINNCLVCGRIVCEQEGSGPCLFCGSL - UNI4232 - VCTNEEQDILQRDSNKSQKLLKKLMSG GAETSGKVDVSTKDLL

PHQESRMKSGLEKAIKHKEKLLEFDRTS SIRRTQVIDDESDYFASDSNQWLSKVEREMLQKREEELRELRHASRLSKKVTIDFAGRKILEDENPLAEYH

SR RLDETIQAIASGTLNQSLVTLDRSCEEPLGVLVNPNMYQASPQ WVDNTGSTPQKKTSLSAGPRLEPSLHQHQLRIQDQEFQEGFDGGWCLSMHQPW

ASLLVRGIKR RVEGRSWYTPHRGRLWIAATGKRPSPQEVSELQATYRLLRGKD - UNI12257 - DVEFPNDYPSGCLLGCVDLIDCLSQKQFQEQ 

- UNI7175 - - UNI28671 - GNWIPRSIKEQRRG
Transcript ENSMUST00000117083
Sequence
GCAGCCCAGCTGGTTCCGGCTGGGGAAGATGGCGGTGGCTGGGGCGGCGTACCGGGAGCCGCTAGTACACTGGTGCACACAGCAGTTGCAAAAAACTTTC

GCCCTGGATGTCAGCGAGGAAATCATACA - UNI19125 - - UNI26065 - - UNI26799 - - UNI30779 - ATATGTTTTGTCAATTGA

GAATGCTGAAGAAATACGAGAATATGTGACAGACCTTCTCCAGGGAAATGAGGGCAAAAAGGGTCAATTCATAGAAGATCTTATAACCAAATGGCAAAAG

AATGATCAAGAGTTCATCTCTGATTCCTTTCAACAGTGCTTGAGAAAAGATG - UNI9268 - AAATTTTAGATGGACAGAGATCAGTGGACCAGCTA

AAGCGGAGTAGGAGGAAAGGACGAAACAAACAGGAAGTTCCTGCATTTCCTGAACCTGACGTAGCTGTGGAGGTCAAAACACCTTTAGATTTGGCTAAG 

GCACAAGAAAGCAACAACTCCGTAAAGAAGAAGACAAGATTTGTCAATTTATATACAAGAGAGGGACAGGACAAACTTGCAGTCCTGCTTCCTGGTCGTC

ACCCGTGTGATTGCCTGGGCCAGAAGCACAAACTCATCAATAACTGTCTGGTCTGTGGGCGGATCGTTTGTGAGCAGGAGGGTTCAGGCCCCTGCTTGTT

CTGTGGCTCTTTG - UNI4232 - GTGTGTACTAATGAAGAACAGGATATTTTACAGCGGGACTCAAACAAAAGTCAGAAACTGCTGAAGAAGCTCAT

GTCAG GGGCAGAGACTTCTGGAAAGGTGGACGTCTCTACCAAGGACCTACTTCCTCATCAAGAATCCCGAATGAAGTCTGGTTTGGAGAAGGCTATCAA

GCATAAGGAAAAACTGTTAGAGTTCGACAGAACGAG TATCCGAAGGACCCAAGTTATTGACGATGAATCAGATTACTTTGCCAGTGATTCTAACCAGTG

GCTGTCCAAAGTTGAGCGAGAAATGCTGCAGAAACGAGAGGAGGAGCTGAGAGAACTCCGACATGCCTCCAGACTTTCTAAGAAAGTGACCATTGACTTC

GCGGGGCGGAAGATCCTAGAAGATGAAAATCCACTAGCAGAGTATCACAGCAG ACTAGATGAGACAATACAAGCCATTGCCAGTGGGACTTTGAACCAG

TCACTGGTCACGTTGGATAGATCTTGTGAAGAGCCTTTGGGAGTTCTGGTAAACCCTAACATGTACCAGGCCTCTCCTCAG TGGGTTGACAACACTGGC

TCAACCCCACAGAAGAAGACTTCACTCTCGGCAGGACCAAGACTAGAGCCCAGTTTACATCAGCACCAGCTGCGAATCCAGGACCAAGAATTCCAGGAAG

GCTTTGATGGCGGCTGGTGCCTGTCTATGCATCAGCCCTGGGCTTCTCTGCTTGTCAGGGGGATTAAAAG GGTGGAGGGCAGATCCTGGTATACTCCTC

ACAGAGGAAGACTTTGGATAGCAGCCACGGGCAAAAGACCTTCCCCTCAGGAAGTCTCAGAACTCCAGGCTACCTATCGTCTTCTTCGTGGGAAAG - U

NI12257 - ATGTGGAGTTTCCAAATGACTATCCGTCGGGTTGTCTTCTGGGCTGTGTGGACCTTATTGATTGCTTGTCCCAGAAACAATTTCAGGAGC

AG - UNI7175 - TTCCCAGACATCAGTCAAGAGTCTGACTCTTCATTTGTTTTCATCTGCAAAAATCCCCAGGAAATGGTTGTGAAGTTCCCTATTA

AAGGAAATCCTAAAATCT - UNI28671 - GGAAACTGGATTCCAAGATCCATCAAGGAGCAAAGAAGGGGTTAATGAAGCAGAATAAAGCTGTCTGA

CCCAGGAAAAAAGGAACTATACAACATAGTGGAGTCTTGTGTACTAAAGTGCTATCCGCTGGGCCTTTGGGATTGAAGCAGTAGAAAGCGAAAAGGCTGG

GCACCAGGCTTCAATCTCTGAGAATCTAAACTCTTACCAAATCTGTGTATTTTTCTTAAAGGATGGAATTCTTTATGAAGTGGGTTACAGATCTTTGAAT

ATGTTATTTATAAAAAAATCATTTT
Translation
MAVAGAAYREPLVHWCTQQLQKTFALDVSEEIIQ - UNI19125 - - UNI26065 - - UNI26799 - - UNI30779 - QYVLSIENAEEIR

EYVTDLLQGNEGKKGQFIEDLITKWQKNDQEFISDSFQQCLRKDE - UNI9268 - EILDGQRSVDQLKRSRRKGRNKQEVPAFPEPDVAVEVKTPLD

LAK AQESNNSVKKKTRFVNLYTREGQDKLAVLLPGRHPCDCLGQKHKLINNCLVCGRIVCEQEGSGPCLFCGSL - UNI4232 - VCTNEEQDILQR

DSNKSQKLLKKLMSG GAETSGKVDVSTKDLLPHQESRMKSGLEKAIKHKEKLLEFDRTS SIRRTQVIDDESDYFASDSNQWLSKVEREMLQKREEELR

ELRHASRLSKKVTIDFAGRKILEDENPLAEYHSR RLDETIQAIASGTLNQSLVTLDRSCEEPLGVLVNPNMYQASPQ WVDNTGSTPQKKTSLSAGPRL

EPSLHQHQLRIQDQEFQEGFDGGWCLSMHQPWASLLVRGIKR RVEGRSWYTPHRGRLWIAATGKRPSPQEVSELQATYRLLRGKD - UNI12257 - 

DVEFPNDYPSGCLLGCVDLIDCLSQKQFQEQ - UNI7175 - FPDISQESDSSFVFICKNPQEMVVKFPIKGNPKIW - UNI28671 - WKLDSKI

HQGAKKGLMKQNKAV
Transcript ENSMUST00000119245
Sequence
GGCCCAACGTAGCTGCTTCCATCAGTTGGTCTCTGACACCAGCTCCAAACTACACACACCTCCTGGAATCCTGGGCCATCTCGGCAGCTCCTCCCAAAGC

TCCTCTCCAGGCCCCTTGCGGGAGCTTCTTTCTCACTGTCTAGCAAGCATCTCCCTCTGGTGGATTTCCTGTCGTTTCAACCAGACTTTTGCATGCATTT

CGTTCTGAACCGGCTCCAGAAGTCGAACAGTGAAGTGG GACACTGGACCCAGGGACATATGCTAGACAGGTACTCCACCAAGGAGCTACAAACACATCT

CTGGTTGTGGTTTTTTTGAGACTATCTCACCATGCACTCCAGGCTGGCTTTAAACTCATGGATCTCCCTGTCTCAATCTTTGTAATTAAAG - UNI206

55 - - UNI30779 - TGAAACTCCAGGAGGCTTAAGATTAATATTCACCGTCTAATTAACCCTTGAGATGATCTTCAAGGCAGTCGTCCAGTTTGAG

CTTCTCAAGGTTTTCTGAGTTACTAAAACCAGTGGGCTGAGTAGATTTGAAGACCTGGTTTTGTTTGCCTTGCAACACTGGATGGGCAGGTGCCACTTGG

TCCAATATTAGTGTGGTCTGGCCTGAGTCTCTAATGGATAAGGCACAGAAAG - UNI30779 - CACAATTGCCACTGGTCGTCCTGGAGTTGCCCCT

CAGTGCCAAAGAATCATCCGAGCACGTTTCTCACTCGTAGATCCGGAAGCTGAGCGAAGCCTGCGCGACCGAGCGGGGCGGTGCAAGCTTGCGGAACCTT

CATCGACGAGGTCGGCGCTGCGAAGGGAACCAGTCCAGGGCGGGACGAGAGGCTTTTGCAGCCCAGCTGGTTCCGGCTGGGGAAGATGGCGGTGGCTGGG

GCGGCGTACCGGGAGCCGCTAGTACACTGGTGCACACAGCAGTTGCAAAAAACTTTCGCCCTGGATGTCAGCGAGGAAATCATACA - UNI19125 - 

- UNI26065 - - UNI26799 - - UNI30779 - ATATGTTTTGTCAATTGAGAATGCTGAAGAAATACGAGAATATGTGACAGACCTTCTCCAG

GGAAATGAGGGCAAAAAGGGTCAATTCATAGAAGATCTTATAACCAAATGGCAAAAGAATGATCAAGAGTTCATCTCTGATTCCTTTCAACAGTGCTTGA

GAAAAGATG - UNI9268 - AAATTTTAGATGGACAGAGATCAGTGGACCAGCTAAAGCGGAGTAGGAGGAAAGGACGAAACAAACAGGAAGTTCCTG

CATTTCCTGAACCTGACGTAGCTGTGGAGGTCAAAACACCTTTAGATTTGGCTAAG GCACAAGAAAGCAACAACTCCGTAAAGAAGAAGACAAGATTTG

TCAATTTATATACAAGAGAGGGACAGGACAAACTTGCAGTCCTGCTTCCTGGTCGTCACCCGTGTGATTGCCTGGGCCAGAAGCACAAACTCATCAATAA

CTGTCTGGTCTGTGGGCGGATCGTTTGTGAGCAGGAGGGTTCAGGCCCCTGCTTGTTCTGTGGCTCTTTG - UNI4232 - GTGTGTACTAATGAAGA

ACAGGATATTTTACAGCGGGACTCAAACAAAAGTCAGAAACTGCTGAAGAAGCTCATGTCAG GGGCAGAGACTTCTGGAAAGGTGGACGTCTCTACCAA

GGACCTACTTCCTCATCAAGAATCCCGAATGAAGTCTGGTTTGGAGAAGGCTATCAAGCATAAGGAAAAACTGTTAGAGTTCGACAGAACGAG TATCCG

AAGGACCCAAGTTATTGACGATGAATCAGATTACTTTGCCAGTGATTCTAACCAGTGGCTGTCCAAAGTTGAGCGAGAAATGCTGCAGAAACGAGAGGAG

GAGCTGAGAGAACTCCGACATGCCTCCAGACTTTCTAAGAAAGTGACCATTGACTTCGCGGGGCGGAAGATCCTAGAAGATGAAAATCCACTAGCAGAGT

ATCACAGCAG ACTAGATGAGACAATACAAGCCATTGCCAGTGGGACTTTGAACCAGTCACTGGTCACGTTGGATAGATCTTGTGAAGAGCCTTTGGGAG

TTCTGGTAAACCCTAACATGTACCAGGCCTCTCCTCAG TGGGTTGACAACACTGGCTCAACCCCACAGAAGAAGACTTCACTCTCGGCAGGACCAAGAC

TAGAGCCCAGTTTACATCAGCACCAGCTGCGAATCCAGGACCAAGAATTCCAGGAAGGCTTTGATGGCGGCTGGTGCCTGTCTATGCATCAGCCCTGGGC

TTCTCTGCTTGTCAGGGGGATTAAAAG GGTGGAGGGCAGATCCTGGTATACTCCTCACAGAGGAAGACTTTGGATAGCAGCCACGGGCAAAAGACCTTC

CCCTCAGGAAGTCTCAGAACTCCAGGCTACCTATCGTCTTCTTCGTGGGAAAG - UNI12257 - ATGTGGAGTTTCCAAATGACTATCCGTCGGGTT

GTCTTCTGGGCTGTGTGGACCTTATTGATTGCTTGTCCCAGAAACAATTTCAGGAGCAG - UNI7175 - TTCCCAGACATCAGTCAAGAGTCTGACT

CTTCATTTGTTTTCATCTGCAAAAATCCCCAGGAAATGGTTGTGAAGTTCCCTATTAAAGGAAATCCTAAAATCT - UNI28671 - GGAAACTGGAT

TCCAAGATCCATCAAGGAGCAAAGAAGGGGTTAATGAAGCAGAATAAAGCTGTCTGACCCAGGAAAAAAGGAACTATACAACATAGTGGAGTCTTGTGTA

CTAAAGTGCTATCCGCTGGGCCTTTGGGATTGAAGCAGTAGAAAGCGAAAAGGCTGGGCACCAGGCTTCAATCTCTGAGAATCTAAACTCTTACCAAATC

TGTGTATTTTTCTTAAAGGATGGAATTCTTTATGAAGTGGGTTACAGATCTTTGAATATGTTATTTATAAAAAAATCATTTTAAAAATTCTAGGTCATTT

TTCTCAGAACTAAATTCAAAACAGGAAGGAACAAATTGGAAATTATTTTCCTCAGTGAGATTTGTATTTTGAATTAGGAAAATCTCAACATAGATTAACA

TTTTTACAAGAGACTCTGAATTTAATTTTTTTTCTCAAAATAATAGAATGGAGACTACTAGGATGTCTGAGGAATCTTTGTTTAACATAAGCCTATGGTG

AAATGAGAATGTTCTTACCAAGTGTTCTGCTTTTGACATCTTGAGACCAGGCCACATTCTGTGACCCAGGCTTGCCTGGAACTCACAACAATCCTCCTGC

CGAAGCCTCTCAAGTGCTGTGTTTACAGGCCAGTAGCCCCATGCTCAGCTTCTAACCCAAATCTCTCAGAGTGGAAAGCTAGAATTCCCAGTATCAGCAG

ATTTTTTTTTCTTTCTTTTTGGAAAAGGTAACATGAAGACATACTTCCTTTTGTTCTTTAGTTTGAGAACATGGGTTAGTCTGGGAAGTGAGGGAGCTAC

CTGCTAATGCAGCCTGAAGCTGCCCTGTTTATTTTGTTAGTGTTGCAAAAGCATCATGTAGATGGGACAATTAGAGAAAAACTTGAAAATACGATCCTTT

GGTAAATACATCAGAAAGCCCTCTAATGCTGAAAACAAGCCCCTTTAAACCTATAAATATCCTAAAAAAGCCATTACTGGAAAAATAAGGTTGGTTTGAA

GTGAGATTTTTCACTGGTCCCTTTAGCCCTTCTCAGGAAGCACTTGTTTCTGAGGCTCTTCTAAAGTGCTATTGGAATCTCAGTTGCTGGAGCCTAGGAA

ATTCATGGTCTCAAATGTGTGTGCTCTGCTTTTTATAAAACACCACTACCACACTAGGGATGTTGGACTCCCTCCAACAGTTTGTGTGCTTGACTTAAAA

AAGAAAGAGCAAGTGAGAAAGAAAAAAAAGTACCTTGTGTTATGAAAAAGATTAATTTCCCTTTCTTTAATCCTTCATATTCAGCATTTATTTGCATTGA

AATGCCTCCACTCATTCCACATTGATGTTCACTCGACTGTGAACTGCCTGTTGCATAGCATTGGTTCTTCGGAGGCTGATCACTCTGGATTCCCAGGGAA

ACCCGAACAGATTCTTGTTCCAGTGATGTACACATGCAGTATTCTCTCTCGTGTTCTGTTGGACCTCTGTGTATAAAGTGGAAGAGGACAGTTAGTGGCA

TTTATTATTGTGAGAGATGTCTTTTTGACCTCTTGGAAACCTTACCATTGTTGAAAGCAAAACTGTGTTTACTATGTAGTTAATAGTTTACCAAGTAGTA

GCACCTTGAATTCCATGCTGAAATTGTCTGGCTTTCTTAATATCACAATAAAATTGAAAGGTAGGATGGGAAGAGAAAA
Translation
  - UNI20655 - - UNI30779 -  - UNI30779 - MAVAGAAYREPLVHWCTQQLQKTFALDVSEEIIQ - UNI19125 - - UNI26065

 - - UNI26799 - - UNI30779 - QYVLSIENAEEIREYVTDLLQGNEGKKGQFIEDLITKWQKNDQEFISDSFQQCLRKDE - UNI9268 - 

EILDGQRSVDQLKRSRRKGRNKQEVPAFPEPDVAVEVKTPLDLAK AQESNNSVKKKTRFVNLYTREGQDKLAVLLPGRHPCDCLGQKHKLINNCLVCGR

IVCEQEGSGPCLFCGSL - UNI4232 - VCTNEEQDILQRDSNKSQKLLKKLMSG GAETSGKVDVSTKDLLPHQESRMKSGLEKAIKHKEKLLEFDR

TS SIRRTQVIDDESDYFASDSNQWLSKVEREMLQKREEELRELRHASRLSKKVTIDFAGRKILEDENPLAEYHSR RLDETIQAIASGTLNQSLVTLDR

SCEEPLGVLVNPNMYQASPQ WVDNTGSTPQKKTSLSAGPRLEPSLHQHQLRIQDQEFQEGFDGGWCLSMHQPWASLLVRGIKR RVEGRSWYTPHRGRL

WIAATGKRPSPQEVSELQATYRLLRGKD - UNI12257 - DVEFPNDYPSGCLLGCVDLIDCLSQKQFQEQ - UNI7175 - FPDISQESDSSFVF

ICKNPQEMVVKFPIKGNPKIW - UNI28671 - WKLDSKIHQGAKKGLMKQNKAV
Transcript ENSMUST00000034952
Sequence
GGGGACTGTTGGTAAGTGGGTTGGGAGCTTCGTTTTCTCATTTGGAAATGTTTTTAGGCCTTTAGTTTACAATGTTAGGCCAGGTAAACCCTTCGCTGCA

GCAGGTAGTAGGCCCAACGTAGCTGCTTCCATCAGTTGGTCTCTGACACCAGCTCCAAACTACACACACCTCCTGGAATCCTGGGCCATCTCGGCAGCTC

CTCCCAAAGCTCCTCTCCAGGCCCCTTGCGGGAGCTTCTTTCTCACTGTCTAGCAAGCATCTCCCTCTGGTGGATTTCCTGTCGTTTCAACCAGACTTTT

GCATGCATTTCGTTCTGAACCGGCTCCAGAAGTCGAACAGTGAAGTGG - UNI20655 - ACACTGGACCCAGGGACATATGCTAGACAGGTACTCCA

CCAAGGAGCTACAAACACATCTCTGGTTGTGGTTTTTTTGAGACTATCTCACCATGCACTCCAGGCTGGCTTTAAACTCATGGATCTCCCTGTCTCAATC

TTTGTAATTAAAG - UNI20655 - - UNI30779 - TGAAACTCCAGGAGGCTTAAGATTAATATTCACCGTCTAATTAACCCTTGAGATGATCTT

CAAGGCAGTCGTCCAGTTTGAGCTTCTCAAGGTTTTCTGAGTTACTAAAACCAGTGGGCTGAGTAGATTTGAAGACCTGGTTTTGTTTGCCTTGCAACAC

TGGATGGGCAGGTGCCACTTGGTCCAATATTAGTGTGGTCTGGCCTGAGTCTCTAATGGATAAGGCACAGAAAG - UNI26799 - - UNI30779 -

 ATCCGGAAGCTGAGCGAAGCCTGCGCGACCGAGCGGGGCGGTGCAAGCTTGCGGAACCTTCATCGACGAGGTCGGCGCTGCGAAGGGAACCAGTCCAGG

GCGGGACGAGAGGCTTTTGCAGCCCAGCTGGTTCCGGCTGGGGAAGATGGCGGTGGCTGGGGCGGCGTACCGGGAGCCGCTAGTACACTGGTGCACACAG

CAGTTGCAAAAAACTTTCGCCCTGGATGTCAGCGAGGAAATCATACA - UNI19125 - - UNI26065 - - UNI26799 - - UNI30779 - 

ATATGTTTTGTCAATTGAGAATGCTGAAGAAATACGAGAATATGTGACAGACCTTCTCCAGGGAAATGAGGGCAAAAAGGGTCAATTCATAGAAGATCTT

ATAACCAAATGGCAAAAGAATGATCAAGAGTTCATCTCTGATTCCTTTCAACAGTGCTTGAGAAAAGATG - UNI9268 - AAATTTTAGATGGACAG

AGATCAGTGGACCAGCTAAAGCGGAGTAGGAGGAAAGGACGAAACAAACAGGAAGTTCCTGCATTTCCTGAACCTGACGTAGCTGTGGAGGTCAAAACAC

CTTTAGATTTGGCTAAG GCACAAGAAAGCAACAACTCCGTAAAGAAGAAGACAAGATTTGTCAATTTATATACAAGAGAGGGACAGGACAAACTTGCAG

TCCTGCTTCCTGGTCGTCACCCGTGTGATTGCCTGGGCCAGAAGCACAAACTCATCAATAACTGTCTGGTCTGTGGGCGGATCGTTTGTGAGCAGGAGGG

TTCAGGCCCCTGCTTGTTCTGTGGCTCTTTG - UNI4232 - GTGTGTACTAATGAAGAACAGGATATTTTACAGCGGGACTCAAACAAAAGTCAGAA

ACTGCTGAAGAAGCTCATGTCAG GGGCAGAGACTTCTGGAAAGGTGGACGTCTCTACCAAGGACCTACTTCCTCATCAAGAATCCCGAATGAAGTCTGG

TTTGGAGAAGGCTATCAAGCATAAGGAAAAACTGTTAGAGTTCGACAGAACGAG TATCCGAAGGACCCAAGTTATTGACGATGAATCAGATTACTTTGC

CAGTGATTCTAACCAGTGGCTGTCCAAAGTTGAGCGAGAAATGCTGCAGAAACGAGAGGAGGAGCTGAGAGAACTCCGACATGCCTCCAGACTTTCTAAG

AAAGTGACCATTGACTTCGCGGGGCGGAAGATCCTAGAAGATGAAAATCCACTAGCAGAGTATCACAGCAG ACTAGATGAGACAATACAAGCCATTGCC

AGTGGGACTTTGAACCAGTCACTGGTCACGTTGGATAGATCTTGTGAAGAGCCTTTGGGAGTTCTGGTAAACCCTAACATGTACCAGGCCTCTCCTCAG 

TGGGTTGACAACACTGGCTCAACCCCACAGAAGAAGACTTCACTCTCGGCAGGACCAAGACTAGAGCCCAGTTTACATCAGCACCAGCTGCGAATCCAGG

ACCAAGAATTCCAGGAAGGCTTTGATGGCGGCTGGTGCCTGTCTATGCATCAGCCCTGGGCTTCTCTGCTTGTCAGGGGGATTAAAAG GGTGGAGGGCA

GATCCTGGTATACTCCTCACAGAGGAAGACTTTGGATAGCAGCCACGGGCAAAAGACCTTCCCCTCAGGAAGTCTCAGAACTCCAGGCTACCTATCGTCT

TCTTCGTGGGAAAG - UNI12257 - ATGTGGAGTTTCCAAATGACTATCCGTCGGGTTGTCTTCTGGGCTGTGTGGACCTTATTGATTGCTTGTCCC

AGAAACAATTTCAGGAGCAG - UNI7175 - TTCCCAGACATCAGTCAAGAGTCTGACTCTTCATTTGTTTTCATCTGCAAAAATCCCCAGGAAATGG

TTGTGAAGTTCCCTATTAAAGGAAATCCTAAAATCT - UNI28671 - GGAAACTGGATTCCAAGATCCATCAAGGAGCAAAGAAGGGGTTAATGAAG

CAGAATAAAGCTGTCTGACCCAGGAAAAAAGGAACTATACAACATAGTGGAGTCTTGTGTACTAAAGTGCTATCCGCTGGGCCTTTGGGATTGAAGCAGT

AGAAAGCGAAAAGGCTGGGCACCAGGCTTCAATCTCTGAGAATCTAAACTCTTACCAAATCTGTGTATTTTTCTTAAAGGATGGAATTCTTTATGAAGTG

GGTTACAGATCTTTGAATATGTTATTTATAAAAAAATCATTTTAAAAATTCTAGGTCATTTTTCTCAGAACTAAATTCAAAACAGGAAGGAACAAATTGG

AAATTATTTTCCTCAGTGAGATTTGTATTTTGAATTAGGAAAATCTCAACATAGATTAACATTTTTACAAGAGACTCTGAATTTAATTTTTTTTCTCAAA

ATAATAGAATGGAGACTACTAGGATGTCTGAGGAATCTTTGTTTAACATAAGCCTATGGTGAAATGAGAATGTTCTTACCAAGTGTTCTGCTTTTGACAT

CTTGAGACCAGGCCACATTCTGTGACCCAGGCTTGCCTGGAACTCACAACAATCCTCCTGCCGAAGCCTCTCAAGTGCTGTGTTTACAGGCCAGTAGCCC

CATGCTCAGCTTCTAACCCAAATCTCTCAGAGTGGAAAGCTAGAATTCCCAGTATCAGCAGATTTTTTTTTCTTTCTTTTTGGAAAAGGTAACATGAAGA

CATACTTCCTTTTGTTCTTTAGTTTGAGAACATGGGTTAGTCTGGGAAGTGAGGGAGCTACCTGCTAATGCAGCCTGAAGCTGCCCTGTTTATTTTGTTA

GTGTTGCAAAAGCATCATGTAGATGGGACAATTAGAGAAAAACTTGAAAATACGATCCTTTGGTAAATACATCAGAAAGCCCTCTAATGCTGAAAACAAG

CCCCTTTAAACCTATAAATATCCTAAAAAAGCCATTACTGGAAAAATAAGGTTGGTTTGAAGTGAGATTTTTCACTGGTCCCTTTAGCCCTTCTCAGGAA

GCACTTGTTTCTGAGGCTCTTCTAAAGTGCTATTGGAATCTCAGTTGCTGGAGCCTAGGAAATTCATGGTCTCAAATGTGTGTGCTCTGCTTTTTATAAA

ACACCACTACCACACTAGGGATGTTGGACTCCCTCCAACAGTTTGTGTGCTTGACTTAAAAAAGAAAGAGCAAG
Translation
 - UNI20655 -  - UNI20655 - - UNI30779 -  - UNI26799 - - UNI30779 - MAVAGAAYREPLVHWCTQQLQKTFALDVSEEI

IQ - UNI19125 - - UNI26065 - - UNI26799 - - UNI30779 - QYVLSIENAEEIREYVTDLLQGNEGKKGQFIEDLITKWQKNDQEF

ISDSFQQCLRKDE - UNI9268 - EILDGQRSVDQLKRSRRKGRNKQEVPAFPEPDVAVEVKTPLDLAK AQESNNSVKKKTRFVNLYTREGQDKLAV

LLPGRHPCDCLGQKHKLINNCLVCGRIVCEQEGSGPCLFCGSL - UNI4232 - VCTNEEQDILQRDSNKSQKLLKKLMSG GAETSGKVDVSTKDLL

PHQESRMKSGLEKAIKHKEKLLEFDRTS SIRRTQVIDDESDYFASDSNQWLSKVEREMLQKREEELRELRHASRLSKKVTIDFAGRKILEDENPLAEYH

SR RLDETIQAIASGTLNQSLVTLDRSCEEPLGVLVNPNMYQASPQ WVDNTGSTPQKKTSLSAGPRLEPSLHQHQLRIQDQEFQEGFDGGWCLSMHQPW

ASLLVRGIKR RVEGRSWYTPHRGRLWIAATGKRPSPQEVSELQATYRLLRGKD - UNI12257 - DVEFPNDYPSGCLLGCVDLIDCLSQKQFQEQ 

- UNI7175 - FPDISQESDSSFVFICKNPQEMVVKFPIKGNPKIW - UNI28671 - WKLDSKIHQGAKKGLMKQNKAV

For any suggestions or comments, please send an email to unitrap@crg.es