Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032393 (Dpp8)
Chromosomal location
Chr 9: 64880265 - 64930457 (+)
Description
dipeptidylpeptidase 8 Gene [Source:MGI Symbol;Acc:MGI:1921638]
RefSeq_dna
NM_028906 
RefSeq_peptide
NP_083182.2 
UniGene
Mm.202749 
MGI
MGI:1921638 
Uniprot/SWISSPROT
Q80YA7 
Uniprot/SPTREMBL
Q3TAE3 
Human Ortholog
ENSG00000074603 (DPP8)
Omim not available
UniTrap UNI25718
Vector Insertion
Chr 9: 64882819 - 64884775
Public Clones not available
Private Clones OST169214 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1554
Vector Insertion
Chr 9: 64890184 - 64891492
Public Clones CC0215 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6402
Vector Insertion
Chr 9: 64893596 - 64899196
Public Clones YHC070 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32895
Vector Insertion
Chr 9: 64908090 - 64911233
Public Clones IST12274E3 (tigm) IST12516F3 (tigm) IST13384C1 (tigm) IST12418B9 (tigm)
IST13725F2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32559
Vector Insertion
Chr 9: 64914304 - 64922245
Public Clones IST11659H4 (tigm) IST10924D8 (tigm) IST10927D7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22077
Vector Insertion
Chr 9: 64922393 - 64923542
Public Clones not available
Private Clones OST309351 (lexicon)
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034960
Sequence
TTCGCCTCCGCCGCTTTTAAGTCCCTTCGTCCGCTGCCTGGGGGCCGCGGGGGCCGCCGCCGAGGAAGCTGCTGTGGCCCCGACGGGAGCGGAGGCGGCG

CGGCATGAAGCGGCGTAGGCCCGCTCCATAGCGCATCCGGACGGTCCGGGCGGGCCCGGGGGGAAG GATTGGATGGTGAGAAAAGGAAAGATTCCTGTG

AGAAGAGATCAGGATGAACGGAGAGATCTGTGCTTAAAGTTGGGCCAGGTGAAAATGATCTCTTTGAAAGTAGAAGAGATCTGAGCAGATGAAAATACCA

TCAG - UNI25718 - GAAGATGCAACATGGCAGCAGCAATGGAAACAGAACAGCTGGGTGTCGAGATATTTGAAACTGCAGAGTGTGAGGAGGGAAA

TGGTGAATCACAGGACCGACCCAAACTGGAGCCTTTTTATGTCGAACGGTATTCTTGGAGTCAGCTGAAAAAGCTGCTTGCTGATACCAGAAAATACCAC

GGCTACATGATGGCTAAGGCGCCACATGACTTTATGTTTGTAAAGAGGACGGATCCAGATGGGCCTCACTCAGACAGGGTCTATTACCTTG CCATGTCT

GGTGAGAACAGAGAAAATACACTATTTTATTCTGAAATCCCTAAAACCATCAACAGAGCAGCAGTCTTAATGCTTTCCTGGAAGCCCCTTTTGGATCTTT

TTCAG - UNI1554 - GCGACACTAGACTATGGGATGTATTCTCGAGAGGAAGAGCTACTCAGAGAAAGAAAGCGCATTGGAACCGTGGGGATCGCAG

CTTATGATTACCACCCAGGAAGCGGAACATTCCTGTTTCAAGCTGGCAGCGGCATTTACCATATCAAAGATGGAGGACCACATGGATTTACA CAACAGC

CTTTGCGGCCCAATTTAGTGGAAACTAGTTGTCCCAATATACGAATGGATCCAAAATTATGCCCTGCTGATCCAGACTGGATAGCTTTCATTCACAGCAA

TGATATTTGGATATCAAACCTCGTAACCAGGGAAGAGCGGAGGATCACATACGTACACAATG - UNI6402 - AGCTAGCCAACATGGAAGAGGATCC

CAGATCAGCTGGTGTTGCCACCTTTGTTCTTCAAGAAGAATTTGACAGATACTCTGGCTACTGGTGGTGTCCCCAAGCGGAAAGAA CTCCTAGTGGTGG

TAAAATTCTTAGAATTCTCTATGAAGAAAATGATGAATCTGAGGTGGAGATTATTCATGTTACGTCCCCCATGTTGGAAACAAGGAGGGCAGATTCCTTT

CGTTATCCCAAAACAG GCACAGCAAACCCAAAGGTCACTTTCAAGATGTCGGAGATTGTTGTTGATGCTGCAGGAGGG ATTATAGATGTCATAGATAA

AGAACTGGTTCAACCTTTCGAGATTCTGTTTGAGGGAGTTGAATATATTGCCAGAGCCGGATGGACTCCAGAGGGAAAACA TGCCTGGTCCATCCTACT

AGACCGTTCCCAGACTCACCTGCAGATAGTTCTGATCTCCCCTGAGTTATTCATCCCAGTAGAAGATGATGCCATGGACAGACAGAGACTTATAGAGTCA

GTTCCTGACTCTGTGACACCACTGATCATCTATGAAGAAACAACAGACATCTGGATAAAT ATCCACGATATTTTTCATGTTTTTCCTCAAACTCATGAA

GATGAAATTGAGTTTATTTTTGCCTCTGAATGCAAAACAGGTTTTCGTCATCTGTATAAAATCACATCCATTTTAAAGGAGAGCAAATATAAACGGTCCA

GTGGTGGACTACCTGCCCCAA GTGATTTCAAGTGTCCTATCAAAGAAGAAATAACAATTACCAGTGGTGAATGGGAAGTACTTGGCCGGCATGGATCTA

AT - UNI32895 - ATCTGGGTTGATGAAGCCAGAAAGCTGGTGTACTTTGAAGGCACCAAAGACTCTCCTTTGGAGCATCACCTGTACGTGACCAGT

TATGCAAACCCTGGAGAAGTGGTGAGGCTGACTGACCGTGGCTACTCACACTCCTGCTGCCTCAGCCGG CATTGTGACTTCTTCATAAGTAAGTACAGC

AACCAGAAGAATCCACACTGTGTGTCCCTCTACAAACTCTCAAGTCCTGAGGATGACCCAGTTCATAAAACAAAGGAATTTTGGGCCACCATTTTGGATT

CAGCAG GTCCTCTTCCTGACTACACCCCTCCAGAAATTTTTTCTTTTGAAAGTACTACTGGATTTACACTGTATGGAATGTTGTATAAGCCTCATGACC

TACAACCTGGAAAGAAATACCCCACTGTGTTATTCATATATGGTGGTCCCCAG - UNI32559 - GTGCAGCTGGTGAACAATCGGTTTAAAGGAGTC

AAGTATTTCCGCCTGAACACCCTGGCCTCCCTGGGTTATGTGGTTGTGGTGATAGACAACAGGGGATCCTGTCACCGAGGACTTAAATTTGAAGGCGCCT

TTAAATATAAAATG - UNI22077 - GGTCAAATAGAAATCGATGATCAAGTGGAAGGACTCCAGTACCTAGCATCTCAGTATGACTTCATTGACTTG

GATCGAGTGGGCATCCACGGCTGGTCCTATGGTGGCTACCTCTCCCTGATGGCATTAATGCAGAGGTCGGATATCTTCCGG GTGGCTATTGCTGGGGCC

CCAGTCACCCTGTGGATCTTCTATGATACAGGATACACGGAGCGCTATATGGGTCACCCTGACCAGAATGAACAGGGCTACTACTTAGGATCTGTGGCCA

TGCAAGCGGAGAAGTTCCCCTCAGA ACCAAACCGGTTACTCCTCTTGCATGGGTTCTTGGATGAGAATGTTCACTTTGCACACACCAGTATATTGCTGA

GTTTTTTAGTGAGGGCTGGAAAGCCATATGACTTACAG ATCTATCCTCAGGAGAGGCACAGCATCAGAGTTCCTGAGTCTGGAGAACACTATGAACTGC

ACCTGCTCCACTACCTTCAGGAGAACCTTGGATCGCGTATCGCTGCTCTGAAAGTGATATAACTCTGACGCATGTAGAACTTGGTGTACACTGTCTAACC

AAACAAAGAGGGTTAGCCAATAGAGAAGCCAGAGTTGATGAACCTACTTTTGTACCTGCCACATAAGATCTATTTCTGAAAGTAAATTTGGTGCCATGCA

GAAATCTGCAGTTCATGGATAGTACTCTAATACCTTAACCATGCACATAAAACTGAGTGACATGTTCCCAAAGGATTGAACAGTACCTGAGGATACTGAA

GGAATCAAGGCACCAGCGCCACATATTCAGACTAGCCTACTTTCACTTTACTAGCAGTATAAGCCTCTTGGACTTAATTAGTGGACTTTACAGTATACTC

TGAGTTTGTTAAAATATGATGATAGTAGTGATTGGTTTGGTTCAATTCCAGGATCTCTGACTAGTTATGGATTTGATAGCACTTACGTCTAATTGAATAG

CTTATGCTTCGTCACTTGGGGTGTATCCAGCATGTCATGAACTAAATACTATTAAGCTTATGACTTTCCCAGTCATTAATAATTTTTCAAGGATAACCTA

GTGGCCTCCTAAAGATACTTACCTGGCTGGTCTCTGACCAGTTTTTTAACCAATTTAAACAGCATCTAGTCTAAGTAATTCTCCTTTTGCTTTGATGATG

TGATGGAGTGGGGTTTTCTTTTACATAAAGGCAAGTAACTATGTAGCATGAGTTTAATCACAAGTCTCAAGATGTTGACAATTATAAGGAAAACATTTTT

AATCAAATTATTTGAAAGCTTGAAAATTAGCAGGCAAGTTTTTTCTCCTTTTAGGAACAGAACATGTACACATTCACATGTATTCTGAAAATATAATGGT

GCCGTTTCCATCTGGCCTTTCCTTAATTAAAGTGTTCCCTAGTTTCCAGGAGGTAAAAGGGTTACAGTGGGAAGGGGGAGACTCTAGTGCAGGGAATGAC

CAGGAAAGACCAGGTAGCAAGGCTCTGCTTCACCATAAATACTCATGAGAAAACCCAGGGTAAATGTAACCCCCGAGTGGCTGGAAACCAGAGCTAGGAG

GTCAAGCTTTGACAGCTACAGGGTCAGTCAGTCTTTGGAGTGGTTACTTTTATAATTCCAGCTTTTTGTTATTTTTCCTTTTAACTTTAAAAACCTTACA

AATCTAAACTTTAACTTTTTTTTATTTGAATGTAATTTAGATATCACTAGCTTAAAAGAAAAAGGTTTCCAGACCACTTCTTGCGGTAAGCTGATCCCTG

ACAAACCATGGCACTCTTTGTGTTGGAAGCCTATCAAGTTAGTTGTGTTACTCGCTCACAGCATTCTCCTGCTTCAGCCTTCCTGCTTGACTATGAAGGG

AAGCATGAGCTTTCAAGTGCTGGCTGGCATCTGCCCTTCCAGTATTAGATGGGTCCCACTGCAGCTAGCCAGACACCTGTGGGTTTGACCCTCATTAATC

ACACCCCAGTGTTTAGACAGTTACCACAACTTAAAAATCACTCCAAGAAAAGTTGCTGTGTTTCTTTCTCACTGCCACATCAGGTCCCTTTCCAAGAGAG

CACAGTGAAGACAGGGACTGCCAGAATAGAGGTGGATGCTTTGGGAAGCCTGGAGATAAATGGCAGGTGACCATGGGCTTCTGTCCTGGGGAGGGAGGGC

TGGGTTTGCCAGCTGTGTGTCTATGTTGTATGATAGACCCCACACTTTTCTTTTTGTTTATCTATTTTGACTTTCATGCTTATGACATTTTCTCGTGCCA

AAATTTGTTTATATTTTTTCAAGTTAAATTAAACTGATTTGGGTAACTTTCCTTCCCCT
Translation
 MKIPSG - UNI25718 - GRCNMAAAMETEQLGVEIFETAECEEGNGESQDRPKLEPFYVERYSWSQLKKLLADTRKYHGYMMAKAPHDFMFVKRTD

PDGPHSDRVYYLA AMSGENRENTLFYSEIPKTINRAAVLMLSWKPLLDLFQ - UNI1554 - ATLDYGMYSREEELLRERKRIGTVGIAAYDYHPGS

GTFLFQAGSGIYHIKDGGPHGFT QQPLRPNLVETSCPNIRMDPKLCPADPDWIAFIHSNDIWISNLVTREERRITYVHNE - UNI6402 - ELANME

EDPRSAGVATFVLQEEFDRYSGYWWCPQAERT TPSGGKILRILYEENDESEVEIIHVTSPMLETRRADSFRYPKTG GTANPKVTFKMSEIVVDAAGG 

IIDVIDKELVQPFEILFEGVEYIARAGWTPEGKH HAWSILLDRSQTHLQIVLISPELFIPVEDDAMDRQRLIESVPDSVTPLIIYEETTDIWIN IHDI

FHVFPQTHEDEIEFIFASECKTGFRHLYKITSILKESKYKRSSGGLPAPS SDFKCPIKEEITITSGEWEVLGRHGSN - UNI32895 - IWVDEARK

LVYFEGTKDSPLEHHLYVTSYANPGEVVRLTDRGYSHSCCLSR HCDFFISKYSNQKNPHCVSLYKLSSPEDDPVHKTKEFWATILDSAG GPLPDYTPP

EIFSFESTTGFTLYGMLYKPHDLQPGKKYPTVLFIYGGPQ - UNI32559 - VQLVNNRFKGVKYFRLNTLASLGYVVVVIDNRGSCHRGLKFEGAFK

YKM - UNI22077 - GQIEIDDQVEGLQYLASQYDFIDLDRVGIHGWSYGGYLSLMALMQRSDIFR VAIAGAPVTLWIFYDTGYTERYMGHPDQNEQ

GYYLGSVAMQAEKFPSE EPNRLLLLHGFLDENVHFAHTSILLSFLVRAGKPYDLQ IYPQERHSIRVPESGEHYELHLLHYLQENLGSRIAALKVI

For any suggestions or comments, please send an email to unitrap@crg.es