Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032400 (Zwilch)
Chromosomal location
Chr 9: 63984951 - 64020911 (-)
Description
Zwilch, kinetochore associated, homolog (Drosophila) Gene [Source:MGI (curated);Acc:Zwilch-001]
RefSeq_dna
NM_026507 
RefSeq_peptide
NP_080783.2 
UniGene
Mm.335237 Mm.474670 
MGI
MGI:1915264 
Uniprot/SWISSPROT
Q8R060 
Human Ortholog
ENSG00000174442 (ZWILCH)
Omim not available
UniTrap UNI18390
Vector Insertion
Chr 9: 64016472 - 64020624
Public Clones E078E03 (ggtc) E078G07 (ggtc) PST19302-NR (escells) IST14220D6 (tigm)
IST14289B6 (tigm) IST13337H1 (tigm)
Private Clones OST424252 (lexicon) OST200478 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3467
Vector Insertion
Chr 9: 64013266 - 64016419
Public Clones AG0247 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24508
Vector Insertion
Chr 9: 64012273 - 64013169
Public Clones not available
Private Clones OST217111 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23439
Vector Insertion
Chr 9: 64010571 - 64012153
Public Clones not available
Private Clones OST259773 (lexicon) OST79491 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4388
Vector Insertion
Chr 9: 64009249 - 64010370
Public Clones AE0497 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4330
Vector Insertion
Chr 9: 64008784 - 64009177
Public Clones AF0831 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5852
Vector Insertion
Chr 9: 64003914 - 64006501
Public Clones CSH710 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8899
Vector Insertion
Chr 9: 63998120 - 64000691
Public Clones XL037 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12220
Vector Insertion
Chr 9: 63987824 - 63991886
Public Clones A039A02 (ggtc)
Private Clones OST348840 (lexicon) OST42808 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000034967
Sequence
AGTTTAACTTCTTAGCAATGGACGGAGGCCACGGCGGTATGTGGTCGCGAATGAACCGCGCGGCGGAGGAGTTTTATGCTCGTCTCCGGCA - UNI183

90 - GGAATTTAATGAAGAGAAGAAAGGAGCCTCTAAAGACCCATTCATCTATGAG - UNI3467 - GCTGATGTACAAGTGCAGTTGATCAGCAAA

GGCCAACCAAGTCTTCTGAAAACTATTCTAAATGAAAATGACTCAGTGTTTCTCGTGGAAAAAGTG - UNI24508 - GTTTTGGAGAAGGAAGAAAC

AAGTCAAGTTGAAGAACTGCAGTCTGAAGAAACTGCTATTTCTGATCTCTCTGCTGGTGAAAATATTAGGCCACTGGCCTTACCTGTTGGGAGAGCAAG 

- UNI23439 - GCAGTTAATTGGGCTCTATACCATGGCTCACAATCCTAATATGACTCATCTGAAGATTAAGCAGCCAGTGACAGCCCTTCCTCCTCT

TTGGGTGAGATGTGACGGTTCAGATCCTGAAGGTACCTGTTGGCTAGGAGCTGAGCTTATCACAACAAATGACATCATTGCAGGCGTTATCCTGTATGTG

CTCACTTGTAAAG - UNI4388 - CTGATAAAAATTACTCTGAAGATCTGGAAAATTTAAAAACTTCACACAAGAAAAGACATCACGTGTCTGCT - 

UNI4330 - GTGACAGCCAGAGGCTTTGCCCAGTATGAGCTCTTTAAGTCTGACGACTTGGATGACACTGTTGCCCCATCACAAACTACAGTCACGCTG

GACCTTTCCTGGAGCCCTGTGGATGAGATGCTCCAAACCCCTCCCCTGTCTTCAACTGCAGCTCTG AATATCAGAGTACAATCAGGAGAGTCCAGAGGT

TGTCTGAGTCATCTTCACAGAGAACTGAAATTTCTCCTT - UNI5852 - GTTTTAGCTGATGGCATCAGGACTGGTGTAACTGAATGGCTTGAGCCT

CTGGAAACAAAATCTGCTCTTGAATTTGTTCAGGAATTTCTGAATG ACTTAAATAAACTGGATGAATTTGATGATTCTACAAAAAAAGATAAACAAAAA

GAG GCAGTGAACCATGACGCAGCTGCAGTTGTCAGGTCCATGCTTCTCACCGTGCGGGGGGATCTCGATTTTGCTGAACAGCTTTGGTGTAGAATGAGC

AGCA GTGTGGTTTCCTATCAAGACTTGGTGAAGTGTTTCACACTCATCCTGCAGAGTCTTCAGCGTGGTGATATACAGCCATGG - UNI8899 - TT

GCACAGTGGAAGTAACAGTTTACTAAGTAAACTCATTCATCAGTCTTACCATGGAGCTATGGACAGTGTCCCTCTCTCTGGAACTACCCCACTGCAGATG

CTTTTGGAAATTGGTTTGGACAAACTGAAGAAAGATTATATCAGCTTTTTTGTCA GTCAGGAACTTGCATCTTTGAATCATTTG GAATACTTCATTTC

TCCCTCAGTATCGACACAGGAACAGGTTTGCCGTGTTCAGAAACTCCATCATATTCTTGAAATCTTAGTCATCTGCATGCTTTTCATTAAACCTCAGCAT

GAGCTTCTCTTCTCTTTAACACA ATCCTGCATAAAATATTATAAACAAAATCCTCTTGATGAGCAACACATTTTTCAGTTGCCAGTCAGACCAGCTGCT

GTCAAGAATTTGTATCAAAG TGAGAAGCCGCAGAAATGGAGAGTGGAGCTCAGCAATAGTCAGAAGAGGGTGAAAACAGTGTGGCAACTGAGTGACAGC

TCCCCTGTAGACCATTCCAGTTTCCACAGGCCTG - UNI12220 - AGTTTCCTGAGCTGACACTGAATGGTAGTCTGGAAGAAAGGACAGCCTTCGT

TAACATGCTTACCTGCAGCCAGGTGCACTTCAAGTAATGCGCACTGCGGGCCCTTGCAAAGGGTCTTCTCTCCG CACAAAACAAAAAGGGGGAAAAGAG

TGAGTTAATTTTCAGAGCCTGAAAAATAGACATCACGTGAACTTCTGCAGCAGAAAAGAAGAGTGATCCTGAAGAGATGCTTTGACAGATGAAGGTGGAG

AGGAGATCCCGTCTCAGCCACGTCTCCTGAGGAGAAGTGTCAGCATCAGGGCAGCAGTGAGGATGGAGAGGGCGCAGACTGTGGGGACCACAATCTCTGA

AGCCACGTGCATGTGCCTAAGCAAGGGCTCTGAAAGGGACAGATACATCCACCAGAAGTGAGCTGTGTTTTGAAACAAAAGCTAAAGGAGATGGGCCACT

GCGTTTCTAATTTTTCTTATTTGTTGTAAAAGTGAACCAGTAAATCAAACATTATTTTG
Translation
MWSRMNRAAEEFYARLRQ - UNI18390 - QEFNEEKKGASKDPFIYE - UNI3467 - ADVQVQLISKGQPSLLKTILNENDSVFLVEKV - UN

I24508 - VLEKEETSQVEELQSEETAISDLSAGENIRPLALPVGRAR - UNI23439 - RQLIGLYTMAHNPNMTHLKIKQPVTALPPLWVRCDGS

DPEGTCWLGAELITTNDIIAGVILYVLTCKA - UNI4388 - ADKNYSEDLENLKTSHKKRHHVSA - UNI4330 - VTARGFAQYELFKSDDLDD

TVAPSQTTVTLDLSWSPVDEMLQTPPLSSTAAL NIRVQSGESRGCLSHLHRELKFLL - UNI5852 - VLADGIRTGVTEWLEPLETKSALEFVQEF

LND DLNKLDEFDDSTKKDKQKE AVNHDAAAVVRSMLLTVRGDLDFAEQLWCRMSSS SVVSYQDLVKCFTLILQSLQRGDIQPW - UNI8899 - L

HSGSNSLLSKLIHQSYHGAMDSVPLSGTTPLQMLLEIGLDKLKKDYISFFVS SQELASLNHL EYFISPSVSTQEQVCRVQKLHHILEILVICMLFIKP

QHELLFSLTQ QSCIKYYKQNPLDEQHIFQLPVRPAAVKNLYQS SEKPQKWRVELSNSQKRVKTVWQLSDSSPVDHSSFHRPE - UNI12220 - EF

PELTLNGSLEERTAFVNMLTCSQVHFK 
Transcript ENSMUST00000122091
Sequence
CTCATCATAACATCTCTTTTAGTCCATTTTTTCCCCCCTAACAGAAATGGGAGACTTTTGGAATAGTAAATTGAGGGGATGCTCTACTAAATTAAAGCAA

TGTGTTAGCGTTGAGTACAAACCGAACTTAAAGCGTGAAGTAGTTCCGGCGGGGCGGGGTCATGGCCTCTGACGTCATTGTCTGGGCGCGCAGTTCAGTT

TAACTTCTTAGCAATGGACGGAGGCCACGGCGGTATGTGGTCGCGAATGAACCGCGCGGCGGAGGAGTTTTATGCTCGTCTCCGGCA - UNI18390 -

 GGAATTTAATGAAGAGAAGAAAGGAGCCTCTAAAGACCCATTCATCTATGAG - UNI3467 - GCTGATGTACAAGTGCAGTTGATCAGCAAAGGCC

AACCAAGTCTTCTGAAAACTATTCTAAATGAAAATGACTCAGTGTTTCTCGTGGAAAAAGTG - UNI24508 - GTTTTGGAGAAGGAAGAAACAAGT

CAAGTTGAAGAACTGCAGTCTGAAGAAACTGCTATTTCTGATCTCTCTGCTGGTGAAAATATTAGGCCACTGGCCTTACCTGTTGGGAGAGCAAG - UN

I23439 - GCAGTTAATTGGGCTCTATACCATGGCTCACAATCCTAATATGACTCATCTGAAGATTAAGCAGCCAGTGACAGCCCTTCCTCCTCTTTGG

GTGAGATGTGACGGTTCAGATCCTGAAGGTACCTGTTGGCTAGGAGCTGAGCTTATCACAACAAATGACATCATTGCAGGCGTTATCCTGTATGTGCTCA

CTTGTAAAG - UNI4388 - CTGATAAAAATTACTCTGAAGATCTGGAAAATTTAAAAACTTCACACAAGAAAAGACATCACGTGTCTGCT - UNI4

330 - GTGACAGCCAGAGGCTTTGCCCAGTATGAGCTCTTTAAGTCTGACGACTTGGATGACACTGTTGCCCCATCACAAACTACAGTCACGCTGGACC

TTTCCTGGAGCCCTGTGGATGAGATGCTCCAAACCCCTCCCCTGTCTTCAACTGCAGCTCTG AATATCAGAGTACAATCAGGAGAGTCCAGAGGTTGTC

TGAGTCATCTTCACAGAGAACTGAAATTTCTCCTT - UNI5852 - GTTTTAGCTGATGGCATCAGGACTGGTGTAACTGAATGGCTTGAGCCTCTGG

AAACAAAATCTGCTCTTGAATTTGTTCAGGAATTTCTGAATG ACTTAAATAAACTGGATGAATTTGATGATTCTACAAAAAAAGATAAACAAAAAGAG 

GCAGTGAACCATGACGCAGCTGCAGTTGTCAGGTCCATGCTTCTCACCGTGCGGGGGGATCTCGATTTTGCTGAACAGCTTTGGTGTAGAATGAGCAGCA

 GTGTGGTTTCCTATCAAGACTTGGTGAAGTGTTTCACACTCATCCTGCAGAGTCTTCAGCGTGGTGATATACAGCCATGG - UNI8899 - TTGCAC

AGTGGAAGTAACAGTTTACTAAGTAAACTCATTCATCAGTCTTACCATGGAGCTATGGACAGTGTCCCTCTCTCTGGAACTACCCCACTGCAGATGCTTT

TGGAAATTGGTTTGGACAAACTGAAGAAAGATTATATCAGCTTTTTTGTCA GTCAGGAACTTGCATCTTTGAATCATTTG GAATACTTCATTTCTCCC

TCAGTATCGACACAGGAACAGGTTTGCCGTGTTCAGAAACTCCATCATATTCTTGAAATCTTAGTCATCTGCATGCTTTTCATTAAACCTCAGCATGAGC

TTCTCTTCTCTTTAACACA ATCCTGCATAAAATATTATAAACAAAATCCTCTTGATGAGCAACACATTTTTCAGTTGCCAGTCAGACCAGCTGCTGTCA

AGAATTTGTATCAAAG TGAGAAGCCGCAGAAATGGAGAGTGGAGCTCAGCAATAGTCAGAAGAGGGTGAAAACAGTGTGGCAACTGAGTGACAGCTCCC

CTGTAGACCATTCCAGTTTCCACAGGCCTG - UNI12220 - AGTTTCCTGAGCTGACACTGAATGGTAGTCTGGAAGAAAGGACAGCCTTCGTTAAC

ATGCTTACCTGCAGCCAGGTGCACTTCAAGTAATGCGCACTGCGGGCCCTTGCAAAGGGTCTTCTCTCCG CACAAAACAAAAAGGGGGAAAAGAGTGAG

TTAATTTTCAGAGCCTGAAAAATAGACATCACGTGAACTTCTGCAGCAGAAAAGAAGAGTGATCCTGAAGAGATGCTTTGACAGATGAAGGTGGAGAGGA

GATCCCGTCTCAGCCACGTCTCCTGAGGAGAAGTGTCAGCATCAGGGCAGCAGTGAGGATGGAGAGGGCGCAGACTGTGGGGACCACAATCTCTGAAGCC

ACGTGCATGTGCCTAAGCAAGGGCTCTGAAAGGGACAGATACATCCACCAGAAGTGAGCTGTGTTTTGAAACAAAAGCTAAAGGAGATGGGCCACTGCGT

TTCTAATTTTTCTTATTTGTTGTAAAAGTGAACCAGTAAATCAAACATTATTTTGAAATGGAGTTTTGGAGCCATGGGACAAAGGCATCATGTTCACTTG

GTATGCACACAGCTTTTGGGAATCCTTACCATCACACAAAACTTACATCAGTGCTGGAAATGTAACAGAAAATCTGGGGATGCCTGACTTTGGTTATTTC

CCTGGTATTTTATTAAGCTTGAGTATGGTTAATATTTATGCTGGCGTTGCATTAATCTCAAAAGATTAGCACCTATATTCCATGGATTCTCTCGGCTTTA

GTCCAAATATTTTTAACTGGGCATGGCAGTACACACCTTTAATCCCAGCACTGAGGAGGCAGAGGCGGCCTGGTCTACAGAGCAAGTTCCAGAAAAACCA

CAGCTACACAGAGAAACCCTGTCTCAAAAGGAAAGACAAAAAGAATCCCTGGGAAACATTTTCAGCTTTTTCAGTTTGTTATTCTCAATATACTTATATC

CTCATATATTACAATTTCTAATGGTAATTCTAATACTTATTTCTTTGTAAACACAAAAATTCACTAAAATGTTAAATTATTTGATAA
Translation
MDGGHGGMWSRMNRAAEEFYARLRQ - UNI18390 - QEFNEEKKGASKDPFIYE - UNI3467 - ADVQVQLISKGQPSLLKTILNENDSVFLVE

KV - UNI24508 - VLEKEETSQVEELQSEETAISDLSAGENIRPLALPVGRAR - UNI23439 - RQLIGLYTMAHNPNMTHLKIKQPVTALPPL

WVRCDGSDPEGTCWLGAELITTNDIIAGVILYVLTCKA - UNI4388 - ADKNYSEDLENLKTSHKKRHHVSA - UNI4330 - VTARGFAQYELF

KSDDLDDTVAPSQTTVTLDLSWSPVDEMLQTPPLSSTAAL NIRVQSGESRGCLSHLHRELKFLL - UNI5852 - VLADGIRTGVTEWLEPLETKSA

LEFVQEFLND DLNKLDEFDDSTKKDKQKE AVNHDAAAVVRSMLLTVRGDLDFAEQLWCRMSSS SVVSYQDLVKCFTLILQSLQRGDIQPW - UNI8

899 - LHSGSNSLLSKLIHQSYHGAMDSVPLSGTTPLQMLLEIGLDKLKKDYISFFVS SQELASLNHL EYFISPSVSTQEQVCRVQKLHHILEILVI

CMLFIKPQHELLFSLTQ QSCIKYYKQNPLDEQHIFQLPVRPAAVKNLYQS SEKPQKWRVELSNSQKRVKTVWQLSDSSPVDHSSFHRPE - UNI122

20 - EFPELTLNGSLEERTAFVNMLTCSQVHFK 

For any suggestions or comments, please send an email to unitrap@crg.es