Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032401 (Lctl)
Chromosomal location
Chr 9: 63964954 - 63985923 (+)
Description
lactase-like Gene [Source:MGI (curated);Acc:Lctl-001]
RefSeq_dna
NM_145835 
RefSeq_peptide
NP_665834.1 
UniGene
Mm.436581 
MGI
MGI:2183549 
Uniprot/SWISSPROT
Q8K1F9 
Human Ortholog
ENSG00000188501 (LCTL)
Omim not available
UniTrap UNI31867
Vector Insertion
Chr 9: 63967656 - 63969412
Public Clones IST13386H7 (tigm) IST13387F7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33660
Vector Insertion
Chr 9: 63969488 - 63969912
Public Clones IST10006C3 (tigm) IST10006B3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31984
Vector Insertion
Chr 9: 63970226 - 63974507
Public Clones IST14499D1 (tigm) IST14702E2 (tigm) IST11081C1 (tigm) IST14673B10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22598
Vector Insertion
Chr 9: 63985612 - 63985913
Public Clones not available
Private Clones OST290596 (lexicon)
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000118215
Sequence
GCGTGCGCGACGGTTGCCAGGCTACCCTGAATTTCTGATCCTCCTGCATCTACCTCCTGAGTGCTAGGCTGAGAG - UNI33660 - ATGCTCCAGGT

AGCATACGGCGGGTGGCAGAATGTGAGTATGACCCGATACTTCAGTGACTATGCTGACCTATGCTTTGAGGTCTTTGGGGACCGAGTGAAGCATTGGCTC

ACATTCAGTGATCCTCGG ACAATGGTAGAAAAAGGTTATGAGACCGGTCTCCACGCACCAGGCCTGAGGCTCCAGGGCACTGGCCTATATGTGGCTGCA

CACCATATCATTAAG - UNI31984 - GCCCACGCCCAGGCTTGGCATTCTTATAATAACACGTGGCGCAGCAAACAGCACG GCCTAGTAGGGATCT

CACTGAACTGTGACTGGGGGGAACCTGTGGACATCGACAACCCCGACGATATTGAGGCTGCTGAGCGATACCTACAGTTCTGTCTCGGTTGGTTTGCCAA

CCCTATTTACGCTGGTGACTACCCCCAAGTCATGAAAGACCACATTG GAACAAAGAGTGCCGAGCAAGGCCTGGAGATGTCGAGGTTGCCCACGTTCTC

CCTGCAGGAGAAGAGCTACCTTAAAGGCACATCTGACTTCCTGGGCCTGGGCCATTTTACCACTCGATACATCACTCAAAGGAAATATCCCTCCCACCAG

GGGCCCAGCTACCAGAATGACCGTGACTTAGTGGAGCTTGTGGACCCCAACTGGCCAGAAATGGGATCCCCATGGCTCTATTCTGTGCCGTGGGGATTCA

GGAGGCTTCTCAACTTTGCCCAG ACTCAGTACGGTGACCCTCCCATATATGTGACAGAAAGTGGAGCGCCCCAAAAGTTACATTGCACTCAGTTCTGCG

ATGAGTGGAGAATCCAGTACCTCAAAGGATACATCAATGAAATGTTAAAAG CTATAAAAGATGGCGTGGATATAAAAGGGTATACTTCCTGGTCTCTGT

TGGATAAGTTTGAATGGGAGAAAGGCTATGCAGATAAATATGGATTCTACTATGTTGAATTCAATGTGAGAAACAAGCCTCGCTATCCCAAGGCTTCTGT

GCAGTATTACAAGGAGATCATCACAGCCAGTGGGTTCCCAAACCCACAAGAG GTGGAAAGTTGGCGTCTCAAAGCCTTGGAAACTTGCTCCATCAACAA

CCAGATGCTTGCCACAG - UNI22598 - GAGACGTGGCTGAGACGGGATCTCCTCTCCACCTTCATCTGTCAAAGCATCTCTTCAGGATCACTCTTC

TTTTCTGCTGCAGAAGTTCACGTGATGTCTATTTTTCAGGCTCTGAAAATTAACTCACTCTTTTCCCCCTTTTTGTTTTGTGCTGTGATTTAAGAAAATA

AAAATAAGCATAAATAAAATGAAAGAAA
Translation
 - UNI33660 - MLQVAYGGWQNVSMTRYFSDYADLCFEVFGDRVKHWLTFSDPR TMVEKGYETGLHAPGLRLQGTGLYVAAHHIIK - UNI3198

4 - AHAQAWHSYNNTWRSKQHG GLVGISLNCDWGEPVDIDNPDDIEAAERYLQFCLGWFANPIYAGDYPQVMKDHIG GTKSAEQGLEMSRLPTFSLQ

EKSYLKGTSDFLGLGHFTTRYITQRKYPSHQGPSYQNDRDLVELVDPNWPEMGSPWLYSVPWGFRRLLNFAQ TQYGDPPIYVTESGAPQKLHCTQFCDE

WRIQYLKGYINEMLKA AIKDGVDIKGYTSWSLLDKFEWEKGYADKYGFYYVEFNVRNKPRYPKASVQYYKEIITASGFPNPQE VESWRLKALETCSIN

NQMLATG - UNI22598 - GDVAETGSPLHLHLSKHLFRITLLFCCRSSRDVYFSGSEN
Transcript ENSMUST00000034969
Sequence
GTTGGTGTCAGGCCACAGATCACACCCCTGACTAGAGGATTCCATGCCTGTAGGTTCTGCTTTGGTGGGGAGTGTGGGGCCCAGGAGTCATTCAGAGAGA

CTGGTAACTGACAACAGTGGCCCTGGGGGTGTCGAGGGCTGAACACCATCTTGG GGTCCCACACACAGCTGCTGTGTGCCCAAGCAAGCCGCTCTGTGG

CCCCTTTCCTTTCCCTCCTGGCCTGTGTCCCTGAGCTGACAGGGGCTCTTAGGCATGGAGGAAGGTGAGGTGTCATGAAGCCAGTGTGGGTCATCATCCT

TGGGTGGATCCTGCTGGTGCCCAGGGTAGGGACTGCCTGGAGAGGACCCCCAGAAGAGGCATCCTTCTACTATGGAACCTTTCCACCCG GCTTCTCCTG

GGGCGTGGGCAGTTCTGCCTACCAGACAGAAGGTGCATGGGACGAGGATGGGAAAGGGCCCAGCATCTGGGATGCCTTCACACATGGCAGAAAGGAACAG

GTGCTAGGAGGTGACACAGCAGACACAGCCTGTGACAGCTACTATAAAGTTCAG GAGGACATTGCCCTGCTGAAGGAACTACAAGTCAGCCACTACCGA

TTTTCCCTGTCTTGGCCGCGGCTCCTGCCCACGGGGGTCAGAG CTGAACAGGTGAACAAGAGAGGAATCAAATTCTACAGCGATTTCATTGACGCTCTC

CTGAAGAGCAACATCACCCCCGTTGTGACCTTGCACCACTGGGACCTACCACAG - UNI31867 - - UNI33660 - ATGCTCCAGGTAGCATACG

GCGGGTGGCAGAATGTGAGTATGACCCGATACTTCAGTGACTATGCTGACCTATGCTTTGAGGTCTTTGGGGACCGAGTGAAGCATTGGCTCACATTCAG

TGATCCTCGG ACAATGGTAGAAAAAGGTTATGAGACCGGTCTCCACGCACCAGGCCTGAGGCTCCAGGGCACTGGCCTATATGTGGCTGCACACCATAT

CATTAAG - UNI31984 - GCCCACGCCCAGGCTTGGCATTCTTATAATAACACGTGGCGCAGCAAACAGCACG GCCTAGTAGGGATCTCACTGAAC

TGTGACTGGGGGGAACCTGTGGACATCGACAACCCCGACGATATTGAGGCTGCTGAGCGATACCTACAGTTCTGTCTCGGTTGGTTTGCCAACCCTATTT

ACGCTGGTGACTACCCCCAAGTCATGAAAGACCACATTG GAACAAAGAGTGCCGAGCAAGGCCTGGAGATGTCGAGGTTGCCCACGTTCTCCCTGCAGG

AGAAGAGCTACCTTAAAGGCACATCTGACTTCCTGGGCCTGGGCCATTTTACCACTCGATACATCACTCAAAGGAAATATCCCTCCCACCAGGGGCCCAG

CTACCAGAATGACCGTGACTTAGTGGAGCTTGTGGACCCCAACTGGCCAGAAATGGGATCCCCATGGCTCTATTCTGTGCCGTGGGGATTCAGGAGGCTT

CTCAACTTTGCCCAG ACTCAGTACGGTGACCCTCCCATATATGTGACAGAAAGTGGAGCGCCCCAAAAGTTACATTGCACTCAGTTCTGCGATGAGTGG

AGAATCCAGTACCTCAAAGGATACATCAATGAAATGTTAAAAG CTATAAAAGATGGCGTGGATATAAAAGGGTATACTTCCTGGTCTCTGTTGGATAAG

TTTGAATGGGAGAAAGGCTATGCAGATAAATATGGATTCTACTATGTTGAATTCAATGTGAGAAACAAGCCTCGCTATCCCAAGGCTTCTGTGCAGTATT

ACAAGGAGATCATCACAGCCAGTGGGTTCCCAAACCCACAAGAG GTGGAAAGTTGGCGTCTCAAAGCCTTGGAAACTTGCTCCATCAACAACCAGATGC

TTGCCACAG - UNI22598 - AGCCCTTGCTTAGGCACATGCACGTGGCTTCAGAGATTGTGGTCCCCACAGTCTGCGCCCTCTCCATCCTCACTGCT

GCCCTGATGCTGACACTTCTCCTCAGGAGACGTGGCTGAGACGGGATCTCCTCTCCACCTTCATCTGTCAAAGCATCTCTTCAGGATCACTCTTCTTTTC

TGCTGCAGAAGTTCACGTGATGTCTATTTTTCAGGCTCTGAAAATTAACTCACTCTTTTCCCCCTTTTTGTTTTGTGCTGTGATTTAAGAAAATAAAAAT

AAGCATAAATAAAATGAAAGAAACCTGTAGTCTC
Translation
 MKPVWVIILGWILLVPRVGTAWRGPPEEASFYYGTFPPG GFSWGVGSSAYQTEGAWDEDGKGPSIWDAFTHGRKEQVLGGDTADTACDSYYKVQ EDI

ALLKELQVSHYRFSLSWPRLLPTGVRA AEQVNKRGIKFYSDFIDALLKSNITPVVTLHHWDLPQ - UNI31867 - - UNI33660 - MLQVAYGG

WQNVSMTRYFSDYADLCFEVFGDRVKHWLTFSDPR TMVEKGYETGLHAPGLRLQGTGLYVAAHHIIK - UNI31984 - AHAQAWHSYNNTWRSKQH

G GLVGISLNCDWGEPVDIDNPDDIEAAERYLQFCLGWFANPIYAGDYPQVMKDHIG GTKSAEQGLEMSRLPTFSLQEKSYLKGTSDFLGLGHFTTRYI

TQRKYPSHQGPSYQNDRDLVELVDPNWPEMGSPWLYSVPWGFRRLLNFAQ TQYGDPPIYVTESGAPQKLHCTQFCDEWRIQYLKGYINEMLKA AIKDG

VDIKGYTSWSLLDKFEWEKGYADKYGFYYVEFNVRNKPRYPKASVQYYKEIITASGFPNPQE VESWRLKALETCSINNQMLATE - UNI22598 - E

PLLRHMHVASEIVVPTVCALSILTAALMLTLLLRRRG

For any suggestions or comments, please send an email to unitrap@crg.es