Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032402 (Smad3)
Chromosomal location
Chr 9: 63494574 - 63605801 (-)
Description
MAD homolog 3 (Drosophila) Gene [Source:MGI (curated);Acc:Smad3-001]
RefSeq_dna
NM_016769 
RefSeq_peptide
NP_058049.2 
UniGene
Mm.7320 Mm.415653 
MGI
MGI:1201674 
Uniprot/SWISSPROT
Q8BUN5 
Uniprot/SPTREMBL
B1B1A1 A2CG44 A2CG45 B1B1A2 Q3V3E0 
Human Ortholog
ENSG00000166949 (SMAD3)
Omim 114500 - COLORECTAL CANCER  
UniTrap UNI27084
Vector Insertion
Chr 9: 63515730 - 63598856
Public Clones not available
Private Clones OST72715 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113930
Sequence
TGGCAAGGTTGCTCCTGGGGTAGGAG - UNI27084 - GTCACTGGATGGTCGGCTGCAGGTGTCCCATCGGAAGGGGCTCCCTCACGTTATCTACTG

CCGCCTGTGGCGATGGCCCGACCTGCACAGCCACCATGAATTACGGGCCATGGAGCTCTGTGAGTTTGCCTTCAACATGAAGAAGGATGAAGTGTGTGTA

AATCCTTACCACTATCAGAGAGTAGAGACGCCAG TTCTACCTCCAGTGTTGGTGCCACGCCACACCGAGATCCCGGCCGAGTTCCCCCCACTGGATGAC

TACAGCCATTCCATTCCCGAGAACACTAACTTCCCTGCTGGCATTGAGCCCCAGAGCAATATTCCAG AAACCCCACCTCCTGGCTACCTGAGTGAAGAT

GGAGAAACCAGTGACCACCAGATGAACCACAGCATGGACGCAG GTTCTCCAAACCTCTCCCCGAATCCGATGTCCCCAGCACACAATAACTTGG ACCT

ACAGCCAGTCACCTACTGTGAGCCGGCCTTCTGGTGCTCCATCTCCTACTACGAGCTGAACCAGCGAGTTGGGGAGACATTCCACGCCTCACAGCCATCC

ATGACAGTAGATGGCTTCACTGACCCCTCCAACTCGGAGCGCTTCTGCCTGGGCCTACTGTCCAATGTCAACCGGAATGCAGCCGTGGAACTTACAAGGC

GACACATTG GGAGAGGTGTGCGGCTCTACTACATCGGAGGGGAGGTCTTTGCGGAGTGCCTCAGTGACAGTGCTATTTTCGTCCAGTCTCCCAACTGCA

ACCAGCGCTATGGCTGGCACCCGGCCACTGTCTGCAAGATCCCACCAG GCTGCAACCTGAAGATCTTCAACAACCAGGAATTTGCTGCCCTCCTAGCTC

AGTCTGTCAACCAGGGCTTTGAGGCTGTCTACCAGCTGACGCGCATGTGCACCATCCGTATGAGCTTCGTCAAAGGCTGGGGAGCAGAGTACAG GAGAC

AGACAGTGACCAGCACCCCCTGCTGGATTGAGCTACACCTGAATGGACCCTTGCAGTGGCTTGACAAGGTCCTCACCCAGATGGGTTCCCCGAGCATCCG

CTGTTCCAGTGTGTCTTAGAGACACTAGGAGTAAAGGGAGCGGGTTGGGGAGGGCGGGCTTGGGGAAAATGACCTTGGAAGAGAACTCCATCCAACTTGG

TCTTGTCAAAGAACACCGATTCCACTCAACTAAGGCACCAGCCTGTTTCTGAGACCACAGAAGAAAACCCCAGGGATGGATTTATGAACAGCTGTGTCTG

CTACATACACGTGCCCCTGTCTGAAGGCCAAGTGATGGCTTCTGTTCTGGTGGCTTGAACTAACAGGTGGTGTATCGCCACCTGACTCCTTGTTTAATGA

CAGAGGTCTGGGATGTCACAGTCCAAAAGGAAAGTGCCTTTCTCCATGGCTGGAGTATGGAGTTTACCTTTGGAGAAGTTGTAATGGAGCATGCCCTGTC

CCACCACTCTCAGAGAGGGTGTACCTGTCAAACTGGATGGCCTACATAGGTACTCCCCCCTACCCCTAGGATGCAGAGAGACGGGAACACGCCGGAGGGT

AGAGCTGGGGAGAACCCATTCTTCCTTGGAAGGATCCGCTGAAGGTCAGCGTATAGGTGATGTACAGTTCCTAATATCACATCAGTCTCAGAGTGTTCAC

AGGAAGCAGC
Translation
WQGCSWGRR - UNI27084 - RSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPV VLPPVLVPRH

TEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPE ETPPPGYLSEDGETSDHQMNHSMDA     
Transcript ENSMUST00000034973
Sequence
GGCGGCACCCAAACAGCTACCCCGTGCGGAAACCCAAACTTTCTACTGCCACTTGGAGTCTCGCGGCCGCCGCCTCCGCCCCGCGCGTCCGGGGCCTGCC

CGTCAGTCCGTCGGTCCGCGTGGAGCAGCTCGGGCGCCGCCGTGCTCCCGATCCCCGCAGCTGCAGCGCCGCAGTCCTGGCCCGGACGCCCGGGCAAGTT

CTCCAGAGTTAAAAGCGAAGTTCGGGCGAGGCGCGGGCCGAGCTGCCTCTGAGCGCCCCCGGCGTCCCCAGTGCGCCCAGCCCCGCCGGGGGCGCCGGTG

ACCCTTCGGTGCCAGCCATGTCGTCCATCCTGCCCTTCACCCCCCCGATCGTGAAGCGCCTGCTGGGTTGGAAGAAGGGCGAGCAGAACGGGCAGGAGGA

GAAGTGGTGCGAGAAGGCGGTCAAGAGCTTGGTGAAGAAGCTCAAGAAGACGGGGCAGTTGGACGAGCTGGAGAAGGCCATCACCACGCAGAACGTGAAC

ACCAAGTGCATTACCATCCCCAG - UNI27084 - GTCACTGGATGGTCGGCTGCAGGTGTCCCATCGGAAGGGGCTCCCTCACGTTATCTACTGCCG

CCTGTGGCGATGGCCCGACCTGCACAGCCACCATGAATTACGGGCCATGGAGCTCTGTGAGTTTGCCTTCAACATGAAGAAGGATGAAGTGTGTGTAAAT

CCTTACCACTATCAGAGAGTAGAGACGCCAG TTCTACCTCCAGTGTTGGTGCCACGCCACACCGAGATCCCGGCCGAGTTCCCCCCACTGGATGACTAC

AGCCATTCCATTCCCGAGAACACTAACTTCCCTGCTGGCATTGAGCCCCAGAGCAATATTCCAG AAACCCCACCTCCTGGCTACCTGAGTGAAGATGGA

GAAACCAGTGACCACCAGATGAACCACAGCATGGACGCAG GTTCTCCAAACCTCTCCCCGAATCCGATGTCCCCAGCACACAATAACTTGG ACCTACA

GCCAGTCACCTACTGTGAGCCGGCCTTCTGGTGCTCCATCTCCTACTACGAGCTGAACCAGCGAGTTGGGGAGACATTCCACGCCTCACAGCCATCCATG

ACAGTAGATGGCTTCACTGACCCCTCCAACTCGGAGCGCTTCTGCCTGGGCCTACTGTCCAATGTCAACCGGAATGCAGCCGTGGAACTTACAAGGCGAC

ACATTG GGAGAGGTGTGCGGCTCTACTACATCGGAGGGGAGGTCTTTGCGGAGTGCCTCAGTGACAGTGCTATTTTCGTCCAGTCTCCCAACTGCAACC

AGCGCTATGGCTGGCACCCGGCCACTGTCTGCAAGATCCCACCAG GCTGCAACCTGAAGATCTTCAACAACCAGGAATTTGCTGCCCTCCTAGCTCAGT

CTGTCAACCAGGGCTTTGAGGCTGTCTACCAGCTGACGCGCATGTGCACCATCCGTATGAGCTTCGTCAAAGGCTGGGGAGCAGAGTACAG GAGACAGA

CAGTGACCAGCACCCCCTGCTGGATTGAGCTACACCTGAATGGACCCTTGCAGTGGCTTGACAAGGTCCTCACCCAGATGGGTTCCCCGAGCATCCGCTG

TTCCAGTGTGTCTTAGAGACACTAGGAGTAAAGGGAGCGGGTTGGGGAGGGCGGGCTTGGGGAAAATGACCTTGGAAGAGAACTCCATCCAACTTGGTCT

TGTCAAAGAACACCGATTCCACTCAACTAAGGCACCAGCCTGTTTCTGAGACCACAGAAGAAAACCCCAGGGATGGATTTATGAACAGCTGTGTCTGCTA

CATACACGTGCCCCTGTCTGAAGGCCAAGTGATGGCTTCTGTTCTGGTGGCTTGAACTAACAGGTGGTGTATCGCCACCTGACTCCTTGTTTAATGACAG

AGGTCTGGGATGTCACAGTCCAAAAGGAAAGTGCCTTTCTCCATGGCTGGAGTATGGAGTTTACCTTTGGAGAAGTTGTAATGGAGCATGCCCTGTCCCA

CCACTCTCAGAGAGGGTGTACCTGTCAAACTGGATGGCCTACATAGGTACTCCCCCCTACCCCTAGGATGCAGAGAGACGGGAACACGCCGGAGGGTAGA

GCTGGGGAGAACCCATTCTTCCTTGGAAGGATCCGCTGAAGGTCAGCGTATAGGTGATGTACAGTTCCTAATATCACATCAGTCTCAGAGTGTTCACAGG

AAGCAGCAAGGGCACTCGTGGAGTATGTGTCCTGGGTGAGGTGGCACCACACCGAATGAATGCATCTCTGGGAGCTGGCACCACAACCCTGATGTATAGG

CTGTGTTGGTTTATGGAGACAAGTTGCATCAATGAATTCACCTAGCATAGGCTCTTTGAAATGTCCTCTGTTTGATAAAAAACAATCCTGGGTACGTATG

TTGGCTGGAAAACCACAATGGACCCTGCCACTGCTTCTTGCCCTGAGGTTTGGAAGCTGAGAGTTATAGAAGCCAATTCACCAGGAGGTAAGACATCCCA

GGCTGACATGGGCAAATGAAAAGGGCTATTAAAATTTTTTTACACCTTGGAAAATTGCAGGCTTGGTGCAGAGCGCTCTGTCATCTTCACCCTGGGATGT

AGGATTACCTAGCTATGGTAAAGGATTGCCACAGCAAACTGTGACACTGTGTAATGAGCACTGTTCCCAGCGGCAATTACAGAGAAAACGAGTGTAAATT

ATTTCAACTGGAAAAAAGTCCCTTTCTTGGCTGTTTTAGAACAGGGTACACAGGATCGCCACCTGCAACTGGTACTCGCTTCTTGGCTGCTGCTTCTGTT

GTGAAAAGACGAGCCCATGTTTCTGCATGGATTTCCCATGGAAGTCCTGTCCTGCTACAGAGGGGAAGAAAGTGTACCCTCCAATGTGATAAATCTTCTG

ATGCCCCCAGACTCTTGGAGCACATCCTGGTGCCCCTCCTGCAGGAGCCTGTGGCATATTTCCAGCTGGGCATGCTGATCCTCCTTGAGACACAGATGCC

TGTGTGAGTCTCCGTTGATACAATTCTGAACCCCTCAGGTTCTCTGAAAGGGCACAGACCATGGGCGTGAACATTGTGCCGTACCTGAGATGGTCTGTGG

ACTGCTGCTTCAGACACACGAGTCCTCGGAACTGCCTGGCTGCCTGTCACGCATGCTCTGAGTCAGAACACACCAACGCTCTGCTGTGGCTCCTAGGGAA

GCATTCATGGTCCTCTGTTATCAGCAGGGGTTTATGTCACTTGCTGTCCGGTTTCCTAGGGGCTTCCTGTGCCCCTTCCCCAGCTATCCTCCAGGTGGCT

AGGGACAGTCTATTCTGCTGCAACTGGAAAGTAGAGGGAACCGGCACTGCTCAGAGCAGATGGCGGCTTCTGGAGGCACACAGTGGGAGTACACCCCTTC

ATGTTATTGGCCAGTTGCTGGAGAATGCTGTAGGAGAAAATTCTAGGCAGGTCTACTCTTGGCATCCCTGAGAGTCAAAGGCTTGGAGTCTAGGAAAGGT

CACACCATGATGGAGAACACAGGTCATTTGGGTACGTGTAATCAAAGTGCCCTCCCAAATCAGTTCTCCTTTTCGTATGAACAGCATCTCTACTTTTAAA

GAGGAGTTGAGGATCGAGAAGATGACAGTGCAGCAGTGGGTGTGGCCTGACTACATGTGCTGTTCCAGCCCTGGGTGCCCACTGACACCGACCCCCAGGC

AGAGGCCTTTGTCTTCAGCACTCCTGAGAAGTTGGCTCTTTACCCCTTCTCCTCTGCTGCCCCTCCTTCCTGCTGGTTCAGGTAGCCCCAGCCACGTGGG

TTAGAGTCCTGTGCTGGCCTGCCATGGCAGCTGGCTACCTTCCAGACCAACTGTAGAGATACCTGGCATTTTGAAGAAAGCCTAGACTGGAGAGCAGGGC

CTCTCTTGGGAAGGACACAAGGCGGGCAAGGCTGCTGGCAGACTTCTCCACTGACCTGAGTGTGCTTTTTTTTTCCCCTAAATGTATTGCATCAAGCCTC

AGTGCTTATGGAGTGCAGTGGTCTTCATCTTCCCCAACTTGCTTCTCAGAGCTGGGATGTATTCCAGAGCCTGATGTTTTTATTCAAACCACAGAAAAGT

TTTCTTTAAGTAGCCTGTGCAGTCATGCATGTGCCTGAGTTGTCTGGAGCAGAGGCAAACATCTGACTTCATTCTTAGCCCCAAGCTGCCATTTCTGAGT

CCTTGAGAGGCTGAGAAGGCTCTAGCTTTGTACTGTATTCTTACTGTGTGACTAGATGCGTGAGCGCTTTACATTAGAAGGAACCTGGTTAGAGCTCGCT

CCTCCTGTCTTTGTGTGGCATTTGTGTTCCATTACCGGCCCCTTTAAGTAACGGCCTTCACAGCACCTTCCCAGTGGGTAGAAAGCCACACACCAGGATG

TGGGTCAACCATGAAGATGTGGCATTGCAGACGGGGGAACATGTGGATGCATGGCTATCGCCCTGAACAGTCCCTGCAGCTACTTGTGTTAACACAGAAC

TGATGTTTAGCATTCTGCCGCTTTCGTATTTATGTAACAATTCCTTAAAGCCATTCAAATGGCTAACTATTTAATTTCTTTAGGACAGTTGTAAAGGTCT

CTCTCCTGAGGACAATGACTTGGAAGAACTGGGGCACAGCCAGTCCCAGACACTGGTGGAGGCTGCAGTGACTTTTTTTGGCTCAAGATCCACAAGCATT

AGAGTAGACTGGGCCAACAAGTCAACAAGTGGTGGCGTGTGCAAACGGGCTGCCCTAGTCAAGCCCAGTCCCTTCAACAGTATGTCTGATGCACCACAGG

CCCTCCCTACTGGAAGTGGGAACTTCAAATGGAAATTGGAGCCATCTTTTATCCCAGAAGCCTTTGCTGCTGCCAGGGCAAGTGGGCTGGTGTGGACTCT

TGTTTAGGAGGCTGAGGTTCTTGTCACTCCTTAGCCAGCCAGGCCTTTAGTGTCTTTGTAAAAAGCATGTATTTATAGTGTTTTAGATTTTTCTAACTTT

TGTATCTTACAGCATTGTACCCCATTGTTAAAGAGCCGTGTCCCCTCTTCTTATAAACGCCCTTCTAATAAACTTTTCACCGTAAAGCTCCTGAGACAGG

AGCACAGTCTG
Translation
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPR - UNI27084 - RSLDGRLQVSHRKGLPH

VIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPV VLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPE ETPP

PGYLSEDGETSDHQMNHSMDAG GSPNLSPNPMSPAHNNLD DLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNV

NRNAAVELTRRHIG GRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPG GCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIR

MSFVKGWGAEYR RRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
Transcript ENSMUST00000113931
Sequence
GGCGGCACCCAAACAGCTACCCCGTGCGGAAACCCAAACTTTCTACTGCCACTTGGAGTCTCGCGGCCGCCGCCTCCGCCCCGCGCGTCCGGGGCCTGCC

CGTCAGTCCGTCGGTCCGCGTGGAGCAGCTCGGGCGCCGCCGTGCTCCCGATCCCCGCAGCTGCAGCGCCGCAGTCCTGGCCCGGACGCCCGGGCAAGTT

CTCCAGAGTTAAAAGCGAAGTTCGGGCGAGGCGCGGGCCGAGCTGCCTCTGAGCGCCCCCGGCGTCCCCAGTGCGCCCAGCCCCGCCGGGGGCGCCGGTG

ACCCTTCGGTGCCAGCCATGTCGTCCATCCTGCCCTTCACCCCCCCGATCGTGAAGCGCCTGCTGGGTTGGAAGAAGGGCGAGCAGAACGGGCAGGAGGA

GAAGTGGTGCGAGAAGGCGGTCAAGAGCTTGGTGAAGAAGCTCAAGAAGACGGGGCAGTTGGACGAGCTGGAGAAGGCCATCACCACGCAGAACGTGAAC

ACCAAGTGCATTACCATCCCCAG - UNI27084 - GTCACTGGATGGTCGGCTGCAGGTGTCCCATCGGAAGGGGCTCCCTCACGTTATCTACTGCCG

CCTGTGGCGATGGCCCGACCTGCACAGCCACCATGAATTACGGGCCATGGAGCTCTGTGAGTTTGCCTTCAACATGAAGAAGGATGAAGTGTGTGTAAAT

CCTTACCACTATCAGAGAGTAGAGACGCCAG TTCTACCTCCAGTGTTGGTGCCACGCCACACCGAGATCCCGGCCGAGTTCCCCCCACTGGATGACTAC

AGCCATTCCATTCCCGAGAACACTAACTTCCCTGCTGGCATTGAGCCCCAGAGCAATATTCCAG AAACCCCACCTCCTGGCTACCTGAGTGAAGATGGA

GAAACCAGTGACCACCAGATGAACCACAGCATGGACGCAG GTTCTCCAAACCTCTCCCCGAATCCGATGTCCCCAGCACACAATAACTTGG ACCTACA

GCCAGTCACCTACTGTGAGCCGGCCTTCTGGTGCTCCATCTCCTACTACGAGCTGAACCAGCGAGTTGGGGAGACATTCCACGCCTCACAGCCATCCATG

ACAGTAGATGGCTTCACTGACCCCTCCAACTCGGAGCGCTTCTGCCTGGGCCTACTGTCCAATGTCAACCGGAATGCAGCCGTGGAACTTACAAGGCGAC

ACATTG GGAGAGGTGTGCGGCTCTACTACATCGGAGGGGAGGTCTTTGCGGAGTGCCTCAGTGACAGTGCTATTTTCGTCCAGTCTCCCAACTGCAACC

AGCGCTATGGCTGGCACCCGGCCACTGTCTGCAAGATCCCACCAG GCTGCAACCTGAAGATCTTCAACAACCAGGAATTTGCTGCCCTCCTAGCTCAGT

CTGTCAACCAGGGCTTTGAGGCTGTCTACCAGCTGACGCGCATGTGCACCATCCGTATGAGCTTCGTCAAAGGCTGGGGAGCAGAGTACAG GAGACAGA

CAGTGACCAGCACCCCCTGCTGGATTGAGCTACACCTGAATGGACCCTTGCAGTGGCTTGACAAGGTCCTCACCCAGATGGGTTCCCCGAGCATCCGCTG

TTCCAGTGTGTCTTAGAGACACTAGGAGTAAAGGGAGCGGGTTGGGGAGGGCGGGCTTGGGGAAAATGACCTTGGAAGAGAACTCCATCCAACTTGGTCT

TGTCAAAGAACACCGATTCCACTCAACTAAGGCACCAGCCTGTTTCTGAGACCACAGAAGAAAACCCCAGGGATGGATTTATGAACAGCTGTGTCTGCTA

CATACACGTGCCCCTGTCTGAAGGCCAAGTGATGGCTTCTGTTCTGGTGGCTTGAACTAACAGGTGGTGTATCGCCACCTGACTCCTTGTTTAATGACAG

AGGTCTGGGATGTCACAGTCCAAAAGGAAAGTGCCTTTCTCCATGGCTGGAGTATGGAGTTTACCTTTGGAGAAGTTGTAATGGAGCATGCCCTGTCCCA

CCACTCTCAGAGAGGGTGTACCTGTCAAACTGGATGGCCTACATAGGTACTCCCCCCTACCCCTAGGATGCAGAGAGACGGGAACACGCCGGAGGGTAGA

GCTGGGGAGAACCCATTCTTCCTTGGAAGGATCCGCTGAAGGTCAGCGTATAGGTGATGTACAGTTCCTAATATCACATCAGTCTCAGAGTGTTCACAGG

AAGCAGCAAGGGCACTCGTGGAGTATGTGTCCTGGGTGAGGTGGCACCACACCGAATGAATGCATCTCTGGGAGCTGGCACCACAACCCTGATGTATAGG

CTGTGTTGGTTTATGGAGACAAGTTGCATCAATGAATTCACCTAGCATAGGCTCTTTGAAATGTCCTCTGTTTGATAAAAAACAATCCTGGGTACGTATG

TTGGCTGGAAAACCACAATGGACCCTGCCACTGCTTCTTGCCCTGAGGTTTGGAAGCTGAGAGTTATAGAAGCCAATTCACCAGGAGGTAAGACATCCCA

GGCTGACATGGGCAAATGAAAAGGGCTATTAAAATTTTTTTACACCTTGGAAAATTGCAGGCTTGGTGCAGAGCGCTCTGTCATCTTCACCCTGGGATGT

AGGATTACCTAGCTATGGTAAAGGATTGCCACAGCAAACTGTGACACTGTGTAATGAGCACTGTTCCCAGCGGCAATTACAGAGAAAACGAGTGTAAATT

ATTTCAACTGGAAAAAAGTCCCTTTCTTGGCTGTTTTAGAACAGGGTACACAGGATCGCCACCTGCAACTGGTACTCGCTTCTTGGCTGCTGCTTCTGTT

GTGAAAAGACGAGCCCATGTTTCTGCATGGATTTCCCATGGAAGTCCTGTCCTGCTACAGAGGGGAAGAAAGTGTACCCTCCAATGTGATAAATCTTCTG

ATGCCCCCAGACTCTTGGAGCACATCCTGGTGCCCCTCCTGCAGGAGCCTGTGGCATATTTCCAGCTGGGCATGCTGATCCTCCTTGAGACACAGATGCC

TGTGTGAGTCTCCGTTGATACAATTCTGAACCCCTCAGGTTCTCTGAAAGGGCACAGACCATGGGCGTGAACATTGTGCCGTACCTGAGATGGTCTGTGG

ACTGCTGCTTCAGACACACGAGTCCTCGGAACTGCCTGGCTGCCTGTCACGCATGCTCTGAGTCAGAACACACCAACGCTCTGCTGTGGCTCCTAGGGAA

GCATTCATGGTCCTCTGTTATCAGCAGGGGTTTATGTCACTTGCTGTCCGGTTTCCTAGGGGCTTCCTGTGCCCCTTCCCCAGCTATCCTCCAGGTGGCT

AGGGACAGTCTATTCTGCTGCAACTGGAAAGTAGAGGGAACCGGCACTGCTCAGAGCAGATGGCGGCTTCTGGAGGCACACAGTGGGAGTACACCCCTTC

ATGTTATTGGCCAGTTGCTGGAGAATGCTGTAGGAGAAAATTCTAGGCAGGTCTACTCTTGGCATCCCTGAGAGTCAAAGGCTTGGAGTCTAGGAAAGGT

CACACCATGATGGAGAACACAGGTCATTTGGGTACGTGTAATCAAAGTGCCCTCCCAAATCAGTTCTCCTTTTCGTATGAACAGCATCTCTACTTTTAAA

GAGGAGTTGAGGATCGAGAAGATGACAGTGCAGCAGTGGGTGTGGCCTGACTACATGTGCTGTTCCAGCCCTGGGTGCCCACTGACACCGACCCCCAGGC

AGAGGCCTTTGTCTTCAGCACTCCTGAGAAGTTGGCTCTTTACCCCTTCTCCTCTGCTGCCCCTCCTTCCTGCTGGTTCAGGTAGCCCCAGCCACGTGGG

TTAGAGTCCTGTGCTGGCCTGCCATGGCAGCTGGCTACCTTCCAGACCAACTGTAGAGATACCTGGCATTTTGAAGAAAGCCTAGACTGGAGAGCAGGGC

CTCTCTTGGGAAGGACACAAGGCGGGCAAGGCTGCTGGCAGACTTCTCCACTGACCTGAGTGTGCTTTTTTTTTCCCCTAAATGTATTGCATCAAGCCTC

AGTGCTTATGGAGTGCAGTGGTCTTCATCTTCCCCAACTTGCTTCTCAGAGCTGGGATGTATTCCAGAGCCTGATGTTTTTATTCAAACCACAGAAAAGT

TTTCTTTAAGTAGCCTGTGCAGTCATGCATGTGCCTGAGTTGTCTGGAGCAGAGGCAAACATCTGACTTCATTCTTAGCCCCAAGCTGCCATTTCTGAGT

CCTTGAGAGGCTGAGAAGGCTCTAGCTTTGTACTGTATTCTTACTGTGTGACTAGATGCGTGAGCGCTTTACATTAGAAGGAACCTGGTTAGAGCTCGCT

CCTCCTGTCTTTGTGTGGCATTTGTGTTCCATTACCGGCCCCTTTAAGTAACGGCCTTCACAGCACCTTCCCAGTGGGTAGAAAGCCACACACCAGGATG

TGGGTCAACCATGAAGATGTGGCATTGCAGACGGGGGAACATGTGGATGCATGGCTATCGCCCTGAACAGTCCCTGCAGCTACTTGTGTTAACACAGAAC

TGATGTTTAGCATTCTGCCGCTTTCGTATTTATGTAACAATTCCTTAAAGCCATTCAAATGGCTAACTATTTAATTTCTTTAGGACAGTTGTAAAGGTCT

CTCTCCTGAGGACAATGACTTGGAAGAACTGGGGCACAGCCAGTCCCAGACACTGGTGGAGGCTGCAGTGACTTTTTTTGGCTCAAGATCCACAAGCATT

AGAGTAGACTGGGCCAACAAGTCAACAAGTGGTGGCGTGTGCAAACGGGCTGCCCTAGTCAAGCCCAGTCCCTTCAACAGTATGTCTGATGCACCACAGG

CCCTCCCTACTGGAAGTGGGAACTTCAAATGGAAATTGGAGCCATCTTTTATCCCAGAAGCCTTTGCTGCTGCCAGGGCAAGTGGGCTGGTGTGGACTCT

TGTTTAGGAGGCTGAGGTTCTTGTCACTCCTTAGCCAGCCAGGCCTTTAGTGTCTTTGTAAAAAGCATGTATTTATAGTGTTTTAGATTTTTCTAACTTT

TGTATCTTACAGCATTGTACCCCATTGTTAAAGAGCCGTGTCCCCTCTTCTTATAAACGCCCTTCTAATAAACTTTTCACCGTAAAGCTCCTGAGACAGG

AGCACAGTCTG
Translation
KRSSGEARAELPLSAPGVPSAPSPAGGAGDPSVPAMSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCI

TIPR - UNI27084 - RSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPV VLPPVLVPRHTEIPA

EFPPLDDYSHSIPENTNFPAGIEPQSNIPE ETPPPGYLSEDGETSDHQMNHSMDAG GSPNLSPNPMSPAHNNLD DLQPVTYCEPAFWCSISYYELNQ

RVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIG GRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPG GC

NLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYR RRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS

For any suggestions or comments, please send an email to unitrap@crg.es