Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032407 (2610101N10Rik)
Chromosomal location
Chr 9: 95360840 - 95412313 (-)
Description
RIKEN cDNA 2610101N10 gene Gene [Source:MGI Symbol;Acc:MGI:1915208]
RefSeq_dna
NM_026476 
RefSeq_peptide
NP_080752.2 NP_001108449.1 
UniGene
Mm.292742 
MGI
MGI:1915208 
Uniprot/SWISSPROT
Q6NV83 
Human Ortholog
ENSG00000163714 (AC018450.26)
Omim not available
UniTrap UNI7302
Vector Insertion
Chr 9: 95403004 - 95412235
Public Clones (sanger) RRT669 (baygenomics) RRF117 (baygenomics) RRR450 (baygenomics)
RRF101 (baygenomics) D104E05 (ggtc) P136B05 (ggtc)
Private Clones OST383138 (lexicon) OST346867 (lexicon) OST39569 (lexicon) OST39561 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3927
Vector Insertion
Chr 9: 95396353 - 95401106
Public Clones AT0133 (sanger)
Private Clones OST417013 (lexicon) OST307945 (lexicon) OST266095 (lexicon) OST166817 (lexicon)
OST108491 (lexicon) OST68658 (lexicon) OST29652 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3890
Vector Insertion
Chr 9: 95394237 - 95396253
Public Clones AW0108 (sanger)
Private Clones OST347586 (lexicon) OST234276 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3047
Vector Insertion
Chr 9: 95393651 - 95394121
Public Clones DA0210 (sanger)
Private Clones OST500098 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4058
Vector Insertion
Chr 9: 95392811 - 95393516
Public Clones AQ0142 (sanger)
Private Clones OST187709 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11590
Vector Insertion
Chr 9: 95391896 - 95392742
Public Clones P062D02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2770
Vector Insertion
Chr 9: 95389209 - 95390118
Public Clones AK0025 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10837
Vector Insertion
Chr 9: 95374907 - 95375620
Public Clones P149C03 (ggtc) PST14623-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8330
Vector Insertion
Chr 9: 95372622 - 95374839
Public Clones STA104 (baygenomics) P149F03 (ggtc) P149C03 (ggtc)
Private Clones OST423878 (lexicon) OST423859 (lexicon) OST32887 (lexicon)
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4127
Vector Insertion
Chr 9: 95367076 - 95372461
Public Clones AN0307 (sanger) AF0091 (sanger) H001E02 (ggtc)
Private Clones OST325422 (lexicon)
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000078374
Sequence
GCTGCCTCCGCTGAAGGAGGAGCAAAGCTCAAGATGGCCGACAAAACGCCAGGCGGATCTCAGAAGGCCAGTTCAAAG - UNI7302 - AACCGATCA

TCAGATGTTCATTCATCTGGATCTTCAGATGCACAT - UNI3927 - CCTCTTCTAGAAAACAAGCTTAAAGCATTCAGTATTGGAAAAATGAGCACA

GCAAAGCGAACCCTAAGTAAGAAGGAACAAGAGGAACTGAAGAAAAAG - UNI3890 - GAGGATGAGAAGGCAGCGGCCGAAATTTATGAGGAATTT

CTTGCTGCTTTTGAAGGAAGTGATGGTAATAAAGTGAAAACGTTTGTTCGAGGCGGGGTTGTTAATGCAGCTAAAG - UNI3047 - ATGAACATGAA

ACAGATGAAAAAAGAGGTAAAATCTATAAACCATCTTCAAGGTTTGCAGATCAAAAAAATCCTCCAAATCAGTCATCCAATGAAAGGCCGCCATCTCTTC

TTGTGATAGAGACGAAAAAACCC - UNI4058 - CCACTGAAAAAAGGGGAGAAGGAAAAGAAAAAAAGCAATTTGGAACTTTTCAAAGAAGAACTAA

AACA - UNI11590 - AATTCAGGAAGAACGTGATGAGAGACATAAAACAAAAGGCAGGTTAAGTCGGTTTGAGCCTCCTCAGTCAGACTCTGATGGT

CAGCGACGTTCTA TGGATGTGCCTTCAAGAAGAAATAGATCGTCTGGTG TTCTTGATGATTATGCACCTGGCTCACATGATGTAGGAGATCCCAGCAC

TACAAATTTATACCTTGGAAACATTAATCCACAG ATGAATGAAGAAATGCTGTGCCAAGAATTTGGAAGATTTGGACCATTAGCTAGTGTAAAAATTAT

GTGGCCTAGAACTGATGAAGAAAGAGCACGAGAAAGAAACTGTGGCTTTGTGGCTTTTATGAACAGAAGAGATGCTGAAAGAGCTCTAAAGAACTTAAAC

G GAAAAATGATTATGTCTTTTGAAATGAAGTTAGGTTGGGGTAAAGCTGTGCCTATTCCTCCACATCCAATATACATTCCGCCTTCTATGATGGAACAC

ACGCTCCCCCCACCTCCATCCGGACTGCCTTTTAATGCGCAGCCTAGAGAGCGATTAAAAAACCCCAATGCTCCCATGTTACCACCACCTAAAAACAAGG

AGGATTTCGAGAAG - UNI2770 - ACTCTGTCGCAAGCCATAGTCAAAGTGGTTATCCCAACAGAAAG GAATTTACTCGCCCTGATACACCGAATG

ATAGAATTTGTTGTACGTGAAGGGCCAATGTTTGAAGCTATGATTATGAACAGAGAAATCAACAATCCTATGTTCAG GTTCTTATTTGAAAACCAGACA

CCAGCCCATGTTTACTACAGGTGGAAGCTTTATTCTATTCTGCAG GGAGATTCTCCAACGAAATGGCGGACAGAAGATTTTCGAATGTTCAAAAATGGA

TCTTTTTGGAGGCCACCACCTTTAAATCCATACCTTCATGGGATGTCAGAGGAGCAAGAGACAGAAGCGTTTGTAGAAGAACCTAGTAAGAAGGGAGCAC

TCAAGGAAGA ACAGCGGGATAAGTTAGAAGAAATCTTGCGAGGATTAACTCCAAGGAAAAATGATATTGGAGATGCCATGGTTTTCTGTCTTAATAATG

CTGAAGCTGCTGAAGAAATAGTGGATTGCATTACTGAGTCGCTGTCCATCTTAAAGACACCTCTTCCCAAGAAG ATTGCCAGATTATATTTGGTTTCTG

ATGTTTTATACAACTCTTCAGCCAAAGTTGCCAATGCTTCATATTACAGGAAATT TTTTGAAACAAAGCTATGCCAGATATTTTCAGACCTCAATGCTA

CTTATCGTACAATTCAAGGCCATTTACAATCTGAAAACTTTAAG CAACGGGTAATGACCTGCTTCAGAGCATGGGAAGATTGGGCAATTTATCCAGAAC

CATTTTTGATCAAACTTCAGAATATTTTCTTAGGACTTGTAAATATCATTGAAGAAAAGGAAACAGAG GATGTGCCGGATGATCTTGACGGTGCTCCCA

TCGAGGAGGAGCTTGACGGGGCGCCTCTGGAGGATGTGGATGGGATTCCCATCGATGCCACTCCCATCGATGACCTGGATGGGGTCCCTATAAAGAGTCT

TGATGATGATCTGGATGGAGTGCCTT TGGATGCAACTGAAGACTCAAAGAAGAATGAACCCATATTTAAAGTTGCCCCATCAAAATGGGAGGCTGTAGA

TGAATCTGAATTGGAAGCACAAG - UNI10837 - CGGTAACGACTTCTAAGTGGGAGTTATTTGACCAGCATGAAGAGTCAGAAGAAGAGGAAAACC

AAAA - UNI8330 - TCAGGAAGAAGAGAGTGAAGATGAAGAAGACACTCAGAGCTCCAAGTCTGAAGAGCATCATTTGTACTCTAACCCAGTCAGAG

AAGAGGCGACTGAGTCTAAGTTCTCTAAGTACTCCGAAATGAGTGAAGAAAAGCGAGCTAAGCTTCGTGAAATTGAG - UNI4127 - CTAAAAGTTA

TGAAGTTTCAAGATGAATTGGAATCTGGAAAGAGACCTAAAAAACCAGGCCAAAGCTTCCAGGAACAAGTAGAGCACTACAGGGATAAACTGCTGCAGCG

G GAGAAGGAAAAAGAATTAGAAAGAGAACGAGAAAGAGACAAAAAAGATAAAGAAAAATTGGAATCTCGATCCAAAGACAAGAAGGAAAAGGATGAATG

TACTCCAACAAGAAAAGAAAG GAAGAGACGACATAGTACCTCCCCCAGCCCTTCTCGAAGTAGCAGTGGTCGGCGTGTGAAATCCCCATCACCCAAATC

AGAGCGCTCTGAACGGTCAGAAAGGTCTCACAAAGAAAGTTCTCGGTCCAGATCCTCTCACAAAGACTCTCCTAGAGACGCTAGCAAAAAAGCCAAAAG 

GTCGCCGTCTGGTTCAAGGACACCTAAAAGGTCTAGGCGCTCTCGCTCTAGGTCCCCTAAGAAATCAGGGAAGAAATCCAGATCTCAGTCCCGGTCTCCA

CACAGGTCTCATAAAAAGTCAAAGAAAAACAAACACTGACGTATATTTCTAAGATGCTGTCACTTATTGGAAATGCAAGTTTGTTTTGTGTCTGAATGGT

TTTTTTTTTCTTATTAAAAAAAAAACCATACACACAAAAACAAAAAAATTCTAATGAAAGAGCATTCCTGGGTTTTGTTTGTTGTTTGTTTGTTTGTGAA

TGCATGTGTAAACTCATGAGTAACTGCATCTGTAGACCTGTCATTGTTTTATATTGTATAAATTACTTTTGTTGTGGCTGTTTTCTCAAGATGAAATTTT

TATTGTGCTAATGAATTTCATCAGAAATATGTCCAATGGATCTGCTGGCAGTAGTAGTATTTTGTTTTAGGATGTTGTGACTTAGACACATAATACAGAT

GTCTTCCCCCCTTTTGTAGCTTTGACAATTTGAATTAGATTTCAAATAAAATCTGAACAGAAAACTATAATGTTGTTTTTTTGCCCAGTTGGTGACACCA

AGTCCCTTAAAGACCTACTAAGTGAATTTGGCACCATTGCTGTTTCTTATCCCTAGTGCACTTTACAAGCTCCAGTGTTCAAGTAGCTAGTGTTTTATAA

TTACTAAAATGACTTTCACAAGTTAAGGGACCCAGTACTCCTGTAGGTTTTGCTCATTCATTTCTGTAAAGAGTTTCATACCTAGAGAACAGAAGGCTCG

AATAGAGCGTATGATGTGTATCTGTTACTGTAGTGCCTGGTTAAAACAGTTCTTTCTCAAAGAAGCAACATGACTTCAAAACACTCAGCCCATCTTCTGA

GCAATTAACGTATTTAGGGTAAATTTAATTTTTATCTTCTATCATGAAACAAGTTTATTTATAAAAGGTTTTATAAAAAATTTACCATAGAATTCTTTTG

TATAATAGTTGCCTTTTTATAATTGTCTGTAGGTTATCTTTAAAACACTGGTATCATGATATTTGTACAAATTTGTTTGAAACAGCTTTTTGTTTTGAAG

GATTTGGTTTGAAGTACAGCTTT
Translation
MADKTPGGSQKASSK - UNI7302 - NRSSDVHSSGSSDAH - UNI3927 - PLLENKLKAFSIGKMSTAKRTLSKKEQEELKKK - UNI3890 

- EDEKAAAEIYEEFLAAFEGSDGNKVKTFVRGGVVNAAKD - UNI3047 - DEHETDEKRGKIYKPSSRFADQKNPPNQSSNERPPSLLVIETKKP 

- UNI4058 - PLKKGEKEKKKSNLELFKEELKQ - UNI11590 - QIQEERDERHKTKGRLSRFEPPQSDSDGQRRSM MDVPSRRNRSSGV VLD

DYAPGSHDVGDPSTTNLYLGNINPQ MNEEMLCQEFGRFGPLASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNG GKMIMSFEMKLGWGKAV

PIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLKNPNAPMLPPPKNKEDFEK - UNI2770 - TLSQAIVKVVIPTER RNLLALIHRMIEFVVRE

GPMFEAMIMNREINNPMFR RFLFENQTPAHVYYRWKLYSILQ GDSPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMSEEQETEAFVEEPSKKGALKEE 

EQRDKLEEILRGLTPRKNDIGDAMVFCLNNAEAAEEIVDCITESLSILKTPLPKK IARLYLVSDVLYNSSAKVANASYYRKF FFETKLCQIFSDLNAT

YRTIQGHLQSENFK QRVMTCFRAWEDWAIYPEPFLIKLQNIFLGLVNIIEEKETE DVPDDLDGAPIEEELDGAPLEDVDGIPIDATPIDDLDGVPIKS

LDDDLDGVPL LDATEDSKKNEPIFKVAPSKWEAVDESELEAQA - UNI10837 - AVTTSKWELFDQHEESEEEENQN - UNI8330 - NQEEES

EDEEDTQSSKSEEHHLYSNPVREEATESKFSKYSEMSEEKRAKLREIE - UNI4127 - LKVMKFQDELESGKRPKKPGQSFQEQVEHYRDKLLQR E

KEKELERERERDKKDKEKLESRSKDKKEKDECTPTRKER RKRRHSTSPSPSRSSSGRRVKSPSPKSERSERSERSHKESSRSRSSHKDSPRDASKKAKR

 RSPSGSRTPKRSRRSRSRSPKKSGKKSRSQSRSPHRSHKKSKKNKH
Transcript ENSMUST00000079659
Sequence
GCTGCCTCCGCTGAAGGAGGAGCAAAGCTCAAGATGGCCGACAAAACGCCAGGCGGATCTCAGAAGGCCAGTTCAAAG - UNI7302 - AACCGATCA

TCAGATGTTCATTCATCTGGATCTTCAGATGCACAT ATGGATGCATCTGGACCCTCAGATAGTGATATGCCAAGTCGAACACGACCTAAAAGCCCAAGA

AAACACAATTATAGGAATGAGAGTTCCCGCGAAAGCCTTTGCGATTCTCCTCATCAGAATCTCTCAAGA - UNI3927 - CCTCTTCTAGAAAACAAG

CTTAAAGCATTCAGTATTGGAAAAATGAGCACAGCAAAGCGAACCCTAAGTAAGAAGGAACAAGAGGAACTGAAGAAAAAG - UNI3890 - GAGGAT

GAGAAGGCAGCGGCCGAAATTTATGAGGAATTTCTTGCTGCTTTTGAAGGAAGTGATGGTAATAAAGTGAAAACGTTTGTTCGAGGCGGGGTTGTTAATG

CAGCTAAAG - UNI3047 - ATGAACATGAAACAGATGAAAAAAGAGGTAAAATCTATAAACCATCTTCAAGGTTTGCAGATCAAAAAAATCCTCCAA

ATCAGTCATCCAATGAAAGGCCGCCATCTCTTCTTGTGATAGAGACGAAAAAACCC - UNI4058 - CCACTGAAAAAAGGGGAGAAGGAAAAGAAAA

AAAGCAATTTGGAACTTTTCAAAGAAGAACTAAAACA - UNI11590 - AATTCAGGAAGAACGTGATGAGAGACATAAAACAAAAGGCAGGTTAAGT

CGGTTTGAGCCTCCTCAGTCAGACTCTGATGGTCAGCGACGTTCTA TGGATGTGCCTTCAAGAAGAAATAGATCGTCTGGTG TTCTTGATGATTATGC

ACCTGGCTCACATGATGTAGGAGATCCCAGCACTACAAATTTATACCTTGGAAACATTAATCCACAG ATGAATGAAGAAATGCTGTGCCAAGAATTTGG

AAGATTTGGACCATTAGCTAGTGTAAAAATTATGTGGCCTAGAACTGATGAAGAAAGAGCACGAGAAAGAAACTGTGGCTTTGTGGCTTTTATGAACAGA

AGAGATGCTGAAAGAGCTCTAAAGAACTTAAACG GAAAAATGATTATGTCTTTTGAAATGAAGTTAGGTTGGGGTAAAGCTGTGCCTATTCCTCCACAT

CCAATATACATTCCGCCTTCTATGATGGAACACACGCTCCCCCCACCTCCATCCGGACTGCCTTTTAATGCGCAGCCTAGAGAGCGATTAAAAAACCCCA

ATGCTCCCATGTTACCACCACCTAAAAACAAGGAGGATTTCGAGAAG - UNI2770 - ACTCTGTCGCAAGCCATAGTCAAAGTGGTTATCCCAACAG

AAAG GAATTTACTCGCCCTGATACACCGAATGATAGAATTTGTTGTACGTGAAGGGCCAATGTTTGAAGCTATGATTATGAACAGAGAAATCAACAATC

CTATGTTCAG GTTCTTATTTGAAAACCAGACACCAGCCCATGTTTACTACAGGTGGAAGCTTTATTCTATTCTGCAG GGAGATTCTCCAACGAAATGG

CGGACAGAAGATTTTCGAATGTTCAAAAATGGATCTTTTTGGAGGCCACCACCTTTAAATCCATACCTTCATGGGATGTCAGAGGAGCAAGAGACAGAAG

CGTTTGTAGAAGAACCTAGTAAGAAGGGAGCACTCAAGGAAGA ACAGCGGGATAAGTTAGAAGAAATCTTGCGAGGATTAACTCCAAGGAAAAATGATA

TTGGAGATGCCATGGTTTTCTGTCTTAATAATGCTGAAGCTGCTGAAGAAATAGTGGATTGCATTACTGAGTCGCTGTCCATCTTAAAGACACCTCTTCC

CAAGAAG ATTGCCAGATTATATTTGGTTTCTGATGTTTTATACAACTCTTCAGCCAAAGTTGCCAATGCTTCATATTACAGGAAATT TTTTGAAACAA

AGCTATGCCAGATATTTTCAGACCTCAATGCTACTTATCGTACAATTCAAGGCCATTTACAATCTGAAAACTTTAAG CAACGGGTAATGACCTGCTTCA

GAGCATGGGAAGATTGGGCAATTTATCCAGAACCATTTTTGATCAAACTTCAGAATATTTTCTTAGGACTTGTAAATATCATTGAAGAAAAGGAAACAGA

G GATGTGCCGGATGATCTTGACGGTGCTCCCATCGAGGAGGAGCTTGACGGGGCGCCTCTGGAGGATGTGGATGGGATTCCCATCGATGCCACTCCCAT

CGATGACCTGGATGGGGTCCCTATAAAGAGTCTTGATGATGATCTGGATGGAGTGCCTT TGGATGCAACTGAAGACTCAAAGAAGAATGAACCCATATT

TAAAGTTGCCCCATCAAAATGGGAGGCTGTAGATGAATCTGAATTGGAAGCACAAG - UNI10837 - CGGTAACGACTTCTAAGTGGGAGTTATTTG

ACCAGCATGAAGAGTCAGAAGAAGAGGAAAACCAAAA - UNI8330 - TCAGGAAGAAGAGAGTGAAGATGAAGAAGACACTCAGAGCTCCAAGTCTG

AAGAGCATCATTTGTACTCTAACCCAGTCAGAGAAGAGGCGACTGAGTCTAAGTTCTCTAAGTACTCCGAAATGAGTGAAGAAAAGCGAGCTAAGCTTCG

TGAAATTGAG - UNI4127 - CTAAAAGTTATGAAGTTTCAAGATGAATTGGAATCTGGAAAGAGACCTAAAAAACCAGGCCAAAGCTTCCAGGAACA

AGTAGAGCACTACAGGGATAAACTGCTGCAGCGG GAGAAGGAAAAAGAATTAGAAAGAGAACGAGAAAGAGACAAAAAAGATAAAGAAAAATTGGAATC

TCGATCCAAAGACAAGAAGGAAAAGGATGAATGTACTCCAACAAGAAAAGAAAG GAAGAGACGACATAGTACCTCCCCCAGCCCTTCTCGAAGTAGCAG

TGGTCGGCGTGTGAAATCCCCATCACCCAAATCAGAGCGCTCTGAACGGTCAGAAAGGTCTCACAAAGAAAGTTCTCGGTCCAGATCCTCTCACAAAGAC

TCTCCTAGAGACGCTAGCAAAAAAGCCAAAAG GTCGCCGTCTGGTTCAAGGACACCTAAAAGGTCTAGGCGCTCTCGCTCTAGGTCCCCTAAGAAATCA

GGGAAGAAATCCAGATCTCAGTCCCGGTCTCCACACAGGTCTCATAAAAAGTCAAAGAAAAACAAACACTGACGTATATTTCTAAGATGCTGTCACTTAT

TGGAAATGCAAGTTTGTTTTGTGTCTGAATGGTTTTTTTTTTCTTATTAAAAAAAAAACCATACACACAAAAACAAAAAAATTCTAATGAAAGAGCATTC

CTGGGTTTTGTTTGTTGTTTGTTTGTTTGTGAATGCATGTGTAAACTCATGAGTAACTGCATCTGTAGACCTGTCATTGTTTTATATTGTATAAATTACT

TTTGTTGTGGCTGTTTTCTCAAGATGAAATTTTTATTGTGCTAATGAATTTCATCAGAAATATGTCCAATGGATCTGCTGGCAGTAGTAGTATTTTGTTT

TAGGATGTTGTGACTTAGACACATAATACAGATGTCTTCCCCCCTTTTGTAGCTTTGACAATTTGAATTAGATTTCAAATAAAATCTGAACAGAAAACTA

TAATGTTGTTTTTTTGCCCAGTTGGTGACACCAAGTCCCTTAAAGACCTACTAAGTGAATTTGGCACCATTGCTGTTTCTTATCCCTAGTGCACTTTACA

AGCTCCAGTGTTCAAGTAGCTAGTGTTTTATAATTACTAAAATGACTTTCACAAGTTAAGGGACCCAGTACTCCTGTAGGTTTTGCTCATTCATTTCTGT

AAAGAGTTTCATACCTAGAGAACAGAAGGCTCGAATAGAGCGTATGATGTGTATCTGTTACTGTAGTGCCTGGTTAAAACAGTTCTTTCTCAAAGAAGCA

ACATGACTTCAAAACACTCAGCCCATCTTCTGAGCAATTAACGTATTTAGGGTAAATTTAATTTTTATCTTCTATCATGAAACAAGTTTATTTATAAAAG

GTTTTATAAAAAATTTACCATAGAATTCTTTTGTATAATAGTTGCCTTTTTATAATTGTCTGTAGGTTATCTTTAAAACACTGGTATCATGATATTTGTA

CAAATTTGTTTGAAACAGCTTTTTGTTTTGAAGGATTTGGTTTGAAGTACAGCTTT
Translation
MADKTPGGSQKASSK - UNI7302 - NRSSDVHSSGSSDAH MDASGPSDSDMPSRTRPKSPRKHNYRNESSRESLCDSPHQNLSR - UNI3927 -

 PLLENKLKAFSIGKMSTAKRTLSKKEQEELKKK - UNI3890 - EDEKAAAEIYEEFLAAFEGSDGNKVKTFVRGGVVNAAKD - UNI3047 - D

EHETDEKRGKIYKPSSRFADQKNPPNQSSNERPPSLLVIETKKP - UNI4058 - PLKKGEKEKKKSNLELFKEELKQ - UNI11590 - QIQEER

DERHKTKGRLSRFEPPQSDSDGQRRSM MDVPSRRNRSSGV VLDDYAPGSHDVGDPSTTNLYLGNINPQ MNEEMLCQEFGRFGPLASVKIMWPRTDEE

RARERNCGFVAFMNRRDAERALKNLNG GKMIMSFEMKLGWGKAVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLKNPNAPMLPPPKNKEDFEK 

- UNI2770 - TLSQAIVKVVIPTER RNLLALIHRMIEFVVREGPMFEAMIMNREINNPMFR RFLFENQTPAHVYYRWKLYSILQ GDSPTKWRTED

FRMFKNGSFWRPPPLNPYLHGMSEEQETEAFVEEPSKKGALKEE EQRDKLEEILRGLTPRKNDIGDAMVFCLNNAEAAEEIVDCITESLSILKTPLPKK

 IARLYLVSDVLYNSSAKVANASYYRKF FFETKLCQIFSDLNATYRTIQGHLQSENFK QRVMTCFRAWEDWAIYPEPFLIKLQNIFLGLVNIIEEKET

E DVPDDLDGAPIEEELDGAPLEDVDGIPIDATPIDDLDGVPIKSLDDDLDGVPL LDATEDSKKNEPIFKVAPSKWEAVDESELEAQA - UNI10837

 - AVTTSKWELFDQHEESEEEENQN - UNI8330 - NQEEESEDEEDTQSSKSEEHHLYSNPVREEATESKFSKYSEMSEEKRAKLREIE - UNI4

127 - LKVMKFQDELESGKRPKKPGQSFQEQVEHYRDKLLQR EKEKELERERERDKKDKEKLESRSKDKKEKDECTPTRKER RKRRHSTSPSPSRSS

SGRRVKSPSPKSERSERSERSHKESSRSRSSHKDSPRDASKKAKR RSPSGSRTPKRSRRSRSRSPKKSGKKSRSQSRSPHRSHKKSKKNKH

For any suggestions or comments, please send an email to unitrap@crg.es