Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032411 (Tfdp2)
Chromosomal location
Chr 9: 96096767 - 96219400 (+)
Description
transcription factor Dp 2 Gene [Source:MGI Symbol;Acc:MGI:107167]
RefSeq_dna
NM_178667 
RefSeq_peptide
NP_848782.2 
UniGene
Mm.406895 Mm.17977 
MGI
MGI:107167 
Uniprot/SWISSPROT
Q64163 
Uniprot/SPTREMBL
Q3TR88 Q3TY79 Q56A02 Q8BHD2 Q8C537 Q8C8M7 
Human Ortholog
ENSG00000114126 (TFDP2)
Omim not available
UniTrap UNI20472
Vector Insertion
Chr 9: 96096980 - 96102549
Public Clones IST10985D9 (tigm) IST11845B9 (tigm) IST14380F2 (tigm) IST12771D6 (tigm)
Private Clones OST361092 (lexicon) OST275248 (lexicon) OST274605 (lexicon) OST232236 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11446
Vector Insertion
Chr 9: 96102608 - 96133100
Public Clones (sanger) E138A02 (ggtc) E048H08 (ggtc) D064C11 (ggtc) M120H01 (ggtc)
E100E10 (ggtc) D184G03 (ggtc) E061H07 (ggtc) D065A04 (ggtc) E119B03 (ggtc)
E077B04 (ggtc) D161H08 (ggtc) 5SE223D06 (ggtc) E001G03 (ggtc) E069C12 (ggtc)
3SE223D06 (ggtc) CMHD-GT_496F3-3 (cmhd) CMHD-GT_516D11-5S (cmhd) CMHD-GT_475H1-3 (cmhd)
CMHD-GT_346H7-3 (cmhd) CMHD-GT_503C9-3 (cmhd) CMHD-GT_471B4-3 (cmhd) CMHD-GT_303H5-3 (cmhd)
FHCRC-GT-S3-5F1 (fhcrc) IST13100D2 (tigm) IST10965D2 (tigm) IST10582E11 (tigm)
IST10194C9 (tigm) IST11594E1 (tigm) IST11103F9 (tigm) IST14887G9 (tigm)
IST11609C7 (tigm) IST14590F11 (tigm) IST11033G7 (tigm) IST10116B4 (tigm)
IST10090B9 (tigm) IST14724E6 (tigm) IST12562C2 (tigm) IST12031B4 (tigm)
IST10031C9 (tigm) IST12668G5 (tigm) IST10568G7 (tigm) IST14989E2 (tigm)
IST12293D7 (tigm) IST14516D11 (tigm) IST12601A11 (tigm) IST10031C9BBR1 (tigm)
IST14839E11 (tigm) IST14830C4 (tigm) IST12369F10 (tigm) IST14254G6 (tigm)
IST12689A9 (tigm) IST14674B2 (tigm) IST14295G4 (tigm) IST14384A8 (tigm)
IST12945D5 (tigm) IST15003G3 (tigm) IST10103E5 (tigm) IST14790B8 (tigm)
IST14225G9 (tigm) IST15059A8 (tigm) IST14047C7 (tigm) IST11763D7 (tigm)
IST12130F6 (tigm) IST14889C10 (tigm) IST13439E6 (tigm) IST13659B2 (tigm)
IST14402G12 (tigm) IST14976G3 (tigm) IST12368B4 (tigm) IST12275B2 (tigm)
IST11623B4 (tigm) IST13845G3 (tigm) IST14659F3 (tigm) IST12756F5 (tigm)
IST14583F2 (tigm) IST14641G8 (tigm) IST12562B8 (tigm)
Private Clones OST466237 (lexicon) OST465961 (lexicon) OST461751 (lexicon) OST434701 (lexicon)
OST432828 (lexicon) OST422377 (lexicon) OST379910 (lexicon) OST379041 (lexicon)
OST377432 (lexicon) OST357395 (lexicon) OST347995 (lexicon) OST345151 (lexicon)
OST323578 (lexicon) OST308641 (lexicon) OST299544 (lexicon) OST297279 (lexicon)
OST278051 (lexicon) OST276428 (lexicon) OST268348 (lexicon) OST255961 (lexicon)
OST208106 (lexicon) OST185485 (lexicon) OST173082 (lexicon) OST173022 (lexicon)
OST171177 (lexicon) OST168138 (lexicon) OST151175 (lexicon) OST146527 (lexicon)
OST142848 (lexicon) OST127841 (lexicon) OST123500 (lexicon) OST121351 (lexicon)
OST121318 (lexicon) OST119193 (lexicon) OST109281 (lexicon) OST76839 (lexicon)
OST67714 (lexicon) OST67408 (lexicon) OST67122 (lexicon) OST58675 (lexicon)
OST41853 (lexicon) OST39371 (lexicon) OST37967 (lexicon) OST37821 (lexicon)
OST36575 (lexicon) OST35747 (lexicon) OST34037 (lexicon) OST32213 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10407
Vector Insertion
Chr 9: 96133168 - 96147468
Public Clones (sanger) D072C11 (ggtc) D133B07 (ggtc) IST11606G5 (tigm) IST10088D5 (tigm)
IST10457E9 (tigm) IST14666B2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13152
Vector Insertion
Chr 9: 96147508 - 96174257
Public Clones E123F07 (ggtc) CMHD-GT_520H10-3 (cmhd) CMHD-GT_323D6-3 (cmhd) IST10136G2 (tigm)
IST14477D10 (tigm)
Private Clones OST456209 (lexicon) OST455632 (lexicon) OST449822 (lexicon) OST448243 (lexicon)
OST442239 (lexicon) OST433282 (lexicon) OST417670 (lexicon) OST381870 (lexicon)
OST381446 (lexicon) OST378161 (lexicon) OST365123 (lexicon) OST339051 (lexicon)
OST332493 (lexicon) OST330987 (lexicon) OST322638 (lexicon) OST320477 (lexicon)
OST313815 (lexicon) OST312173 (lexicon) OST306361 (lexicon) OST304497 (lexicon)
OST302234 (lexicon) OST300433 (lexicon) OST300245 (lexicon) OST292351 (lexicon)
OST274653 (lexicon) OST261299 (lexicon) OST260631 (lexicon) OST260109 (lexicon)
OST259260 (lexicon) OST252736 (lexicon) OST242171 (lexicon) OST240470 (lexicon)
OST224562 (lexicon) OST206786 (lexicon) OST204613 (lexicon) OST199274 (lexicon)
OST197777 (lexicon) OST194497 (lexicon) OST193476 (lexicon) OST187339 (lexicon)
OST187315 (lexicon) OST171197 (lexicon) OST171181 (lexicon) OST149005 (lexicon)
OST147384 (lexicon) OST143359 (lexicon) OST130360 (lexicon) OST128447 (lexicon)
OST124482 (lexicon) OST115485 (lexicon) OST109196 (lexicon) OST109146 (lexicon)
OST98651 (lexicon) OST85488 (lexicon) OST85444 (lexicon) OST83994 (lexicon)
OST83778 (lexicon) OST68895 (lexicon) OST68196 (lexicon) OST67130 (lexicon)
OST65917 (lexicon) OST65799 (lexicon) OST64795 (lexicon) OST64693 (lexicon)
OST64650 (lexicon) OST64601 (lexicon) OST64086 (lexicon) OST63863 (lexicon)
OST62564 (lexicon) OST59135 (lexicon) OST56749 (lexicon) OST55637 (lexicon)
OST43084 (lexicon) OST42643 (lexicon) OST40296 (lexicon) OST39277 (lexicon)
OST35157 (lexicon) OST35152 (lexicon) OST33890 (lexicon) OST30915 (lexicon)
OST7939 (lexicon) OST764 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2193
Vector Insertion
Chr 9: 96174362 - 96188019
Public Clones XR1044 (sanger) CMHD-GT_299E7-3 (cmhd) CMHD-GT_78F10-3 (cmhd) IST10846F11 (tigm)
Private Clones OST453514 (lexicon) OST447877 (lexicon) OST433270 (lexicon) OST416168 (lexicon)
OST392011 (lexicon) OST384195 (lexicon) OST371624 (lexicon) OST335873 (lexicon)
OST327815 (lexicon) OST319428 (lexicon) OST308754 (lexicon) OST298652 (lexicon)
OST297057 (lexicon) OST269741 (lexicon) OST249298 (lexicon) OST238272 (lexicon)
OST236407 (lexicon) OST235593 (lexicon) OST233731 (lexicon) OST230663 (lexicon)
OST222692 (lexicon) OST210710 (lexicon) OST210427 (lexicon) OST202069 (lexicon)
OST199507 (lexicon) OST124350 (lexicon) OST123272 (lexicon) OST108071 (lexicon)
OST103782 (lexicon) OST99759 (lexicon) OST87745 (lexicon) OST81119 (lexicon)
OST74770 (lexicon) OST69085 (lexicon) OST55158 (lexicon) OST54854 (lexicon)
OST54577 (lexicon) OST43177 (lexicon) OST41129 (lexicon) OST41070 (lexicon)
OST33892 (lexicon) OST32865 (lexicon) OST30260 (lexicon) OST26664 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20435
Vector Insertion
Chr 9: 96188142 - 96190998
Public Clones not available
Private Clones OST363394 (lexicon) OST122891 (lexicon) OST122652 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18015
Vector Insertion
Chr 9: 96191047 - 96195383
Public Clones not available
Private Clones OST432118 (lexicon) OST408982 (lexicon) OST376442 (lexicon) OST375518 (lexicon)
OST375477 (lexicon) OST305599 (lexicon) OST274084 (lexicon) OST222310 (lexicon)
OST185368 (lexicon) OST128052 (lexicon) OST81260 (lexicon) OST64667 (lexicon)
OST42678 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1075
Vector Insertion
Chr 9: 96195547 - 96198042
Public Clones CC0182 (sanger) CC0048 (sanger)
Private Clones OST405791 (lexicon) OST297979 (lexicon) OST42358 (lexicon)
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34060
Vector Insertion
Chr 9: 96211108 - 96217895
Public Clones IST11943G12 (tigm) IST14626D5 (tigm) IST10561F1 (tigm) IST14168G5 (tigm)
IST11653E1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112962
Sequence
GTGCGGCCGTCGCTGCCTGGCACGCGGGGCGCGCCTTGACCCTTCCTGCACTGCAGGCTTCCGACGCGCGCGAAGACCGCGGCTGCGCGGCCGGGAGCTT

GCTCCGAGCGGACCTGGCTCTGCCTGAGGAGCGGCGGCTCGCGAAGAAGCGTCTCCCCGGGAGTGGGCCGAGGGCTGTGTGGACCGGCGGCGGCCCCTCT

GCACCAAGCTGCG - UNI20472 - GTTTCTGTTAAAATAAGCATTCTGACAAACTGCTGAAGAGAGAGCCCTGATAGACTAG - UNI11446 - G

TTGGTTTGCCATCCACAAATGCAGAGCTGAGGGGCTTTATAGATCAGAATTTCAGTCCAACGAAAG - UNI10407 - GTAAATAAATACCTACAAGT

GGAATTGCTGGGTCATACG - UNI13152 - GTAACATTTCACTTGTTGCCTTTCCAGTTTCAAGCACCAACTCACCAACAAAGATTTTACCGAAAAC

CTTAGGGCCAATAAATGTGAATGTTGGACCCCAAATG - UNI2193 - ATTATAAGCACACCGCAGAGAATTGCCAATTCAGGAAGTGTTCTGATTGG

GAATCCATATACCCCTGCACCCGCAATGGTCACTCAGACTCACATAGCTGAGGCTGCTGGCTGGGTTCCCAG - UNI18015 - - UNI20435 - T

AAACGAAGCAAAAAAGGAGATAAAAATGGGAAAGGCTTGAGACATTTTTCAATGAAGGTGTGTGAGAAAGTTCAGCGGAAAGGCACAACGTCATACAATG

AGGTAGCTGATGAGCTGGTATCTGAGTTTACCAACTCAAATAACCATCTGGCAGCTGATTCG - UNI1075 - CAGGCTTATGATCAGAAGAACATTA

GACGAAGAGTTTATGATGCTTTAAATGTACTAATGGCGATGAACATAATTTCAAAGGAAAAAAAAGAAATCAAGTGGATTGGCCTGCCTACCAATTCTGC

TCAGGAATGCCAGAACCTGGAA ATCGAGAAGCAGAGGCGGATAGAACGGATAAAGCAGAAGCGAGCCCAGCTACAAGAACTTCTCCTTCAG CAAATTG

CTTTTAAAAACCTGGTACAGAGAAATCGACAAAATGAACAACAAAACCAGGGCCCTCCAGCTGTGAATTCCACCATTCAGCTGCCATTTATAATCATTAA

TACAAGCAGGAAAACAGTCATAGACTGCAGCATCTCCAGTGACAA ATTTGAATACCTTTTTAATTTTGATAACACCTTTGAGATCCACGACGACATAGA

GGTACTGAAGCGGATGGGAATGTCCTTTGGTCTGGAGTCAGGCAAATGCTCTCTGGAGGATCTGAAAATCGCAAAATCCCTGGTTCCAAAAGCTTTAGAA

GGCTATATTACAG - UNI34060 - ATATCTCCACAGGACCTTCTTGGTTAAATCAGGGACTACTTTTGAACTCTACCCAATCAGTTTCAAATTTAGA

CCCGACCACCGGTGCCACTGTACCCCAATCAAG TGTAAACCAAGGGTTGTGCTTGGATGCTGAAGTGGCCTTAGCAACTGGGCAGCTCCCTGCCTCAAA

CAGTCACCAGTCCAGCAGTGCAGCCTCTCACTTCTCGGAGTCCCGCGGCGAGACCCCCTGTTCATTCAACGATGAAGATGAGGAAGATGAAGAGGAGGAT

CCCTCCTCCCCAGAATAAAGACAGGAGAGAACTCATGTTTTAATATTTGATGCTCATATGTGTCTTTAGTGTGAGCTCTTGTGTTTTGAAATGATTGCTT

CAGTCTTTGCCTTTGTTTGCATTTGTGTTTAGTGAAAACTAGAGAAACACAATAAGCAAATCACTTGAAGGCTGAGATGATTGAACTGAAAGTTCCCATA

GCGTGGATGAAACCGAGCAGCAGAGCAGCAGGACATGGCCAACAAAGCGTGCTTTCTGAGGACGTGGAGAGTGGCAGTGACGAAGGTCATTTGTTTTCAG

GGAGGTAGGGTTTAAAGACCCCCAGTGGGAGCATTTAGATGGCAGGCGGCTGCAAGGAGTCTGCAGTGGTAACAGCTTCTCTCTAGCCTGGCTGGCTTTG

GTAGGCAAAAGTGAACTTGGAAGTCACAGTGGGATCAGAGGGGTGTAGGTTGCGATCCTTGTCGCCTGAGGAGCCGGTGGACTGCTGAGCTAGTCCAGGG

GTAGCCGGTCCCCTCATGCATCTGCTGCCTTAGCTTCTAGAACGGAGCAAGCTTTTACGTACCTAGGTGACATGTAGAAAAATTTACAGTAAACTGAAAT

GACCATTTGTCAATGCATTGGTGCATAGGAGTTACTAGGGCTACTTCTGGAAGCCAAAATAGAATAGCATCTCCATGTGCATTAAAAACTTCGCCAGCAC

TGCCTTTTGCCAGCATTCTAAATTTGGAGTTTTACTGAGAAGGAAACTGTTTTTATAGTTTTAATCAGAGCTATGCATTTCATACAGCTTTTTAATTTAC

AATGAAACAAAGAAACAAATTCCTTTGACCAAATTGCTTGTCTATAGTTGTCTGCAGTACTGTATGATTTTACCCATGTGCAATTTGTAAAATGAACCAG

ATGTCACTACTTTTGTCTTTATTTCAAGAATATGGCCATCACTGTTCTCTTATACATGTTCTTTTCCATATTTTAATTATCAAAATGACCATATCAGACT

TATTCCTGGGTAAATTGCATTTCAAACT
Translation
 - UNI20472 -  - UNI11446 -  - UNI10407 -  - UNI13152 - M - UNI2193 - IISTPQRIANSGSVLIGNPYTPAPAMVTQT

HIAEAAGWVPS - UNI18015 - - UNI20435 - SKRSKKGDKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVSEFTNSNNHLAADS - UNI1

075 - QAYDQKNIRRRVYDALNVLMAMNIISKEKKEIKWIGLPTNSAQECQNLE IEKQRRIERIKQKRAQLQELLLQ QIAFKNLVQRNRQNEQQNQG

PPAVNSTIQLPFIIINTSRKTVIDCSISSDK KFEYLFNFDNTFEIHDDIEVLKRMGMSFGLESGKCSLEDLKIAKSLVPKALEGYITD - UNI34060

 - DISTGPSWLNQGLLLNSTQSVSNLDPTTGATVPQSS SVNQGLCLDAEVALATGQLPASNSHQSSSAASHFSESRGETPCSFNDEDEEDEEEDPSSP

E
Transcript ENSMUST00000034982
Sequence
GTGCGGCCGTCGCTGCCTGGCACGCGGGGCGCGCCTTGACCCTTCCTGCACTGCAGGCTTCCGACGCGCGCGAAGACCGCGGCTGCGCGGCCGGGAGCTT

GCTCCGAGCGGACCTGGCTCTGCCTGAGGAGCGGCGGCTCGCGAAGAAGCGTCTCCCCGGGAGTGGGCCGAGGGCTGTGTGGACCGGCGGCGGCCCCTCT

GCACCAAGCTGCG - UNI20472 - GTTTCTGTTAAAATAAGCATTCTGACAAACTGCTGAAGAGAGAGCCCTGATAGACTAG - UNI11446 - G

TTGGTTTGCCATCCACAAATGCAGAGCTGAGGGGCTTTATAGATCAGAATTTCAGTCCAACGAAAG - UNI10407 - GTAAATAAATACCTACAAGT

GGAATTGCTGGGTCATACG - UNI13152 - GTAACATTTCACTTGTTGCCTTTCCAGTTTCAAGCACCAACTCACCAACAAAGATTTTACCGAAAAC

CTTAGGGCCAATAAATGTGAATGTTGGACCCCAAATG - UNI2193 - ATTATAAGCACACCGCAGAGAATTGCCAATTCAGGAAGTGTTCTGATTGG

GAATCCATATACCCCTGCACCCGCAATGGTCACTCAGACTCACATAGCTGAGGCTGCTGGCTGGGTTCCCAG - UNI20435 - TGATAGAAAACGAG

CTAGAGAATTTATAGACTCTGATTTTTCAGAAAG - UNI18015 - TAAACGAAGCAAAAAAGGAGATAAAAATGGGAAAGGCTTGAGACATTTTTCA

ATGAAGGTGTGTGAGAAAGTTCAGCGGAAAGGCACAACGTCATACAATGAGGTAGCTGATGAGCTGGTATCTGAGTTTACCAACTCAAATAACCATCTGG

CAGCTGATTCG - UNI1075 - GCTTATGATCAGAAGAACATTAGACGAAGAGTTTATGATGCTTTAAATGTACTAATGGCGATGAACATAATTTCAA

AGGAAAAAAAAGAAATCAAGTGGATTGGCCTGCCTACCAATTCTGCTCAGGAATGCCAGAACCTGGAA ATCGAGAAGCAGAGGCGGATAGAACGGATAA

AGCAGAAGCGAGCCCAGCTACAAGAACTTCTCCTTCAG CAAATTGCTTTTAAAAACCTGGTACAGAGAAATCGACAAAATGAACAACAAAACCAGGGCC

CTCCAGCTGTGAATTCCACCATTCAGCTGCCATTTATAATCATTAATACAAGCAGGAAAACAGTCATAGACTGCAGCATCTCCAGTGACAA ATTTGAAT

ACCTTTTTAATTTTGATAACACCTTTGAGATCCACGACGACATAGAGGTACTGAAGCGGATGGGAATGTCCTTTGGTCTGGAGTCAGGCAAATGCTCTCT

GGAGGATCTGAAAATCGCAAAATCCCTGGTTCCAAAAGCTTTAGAAGGCTATATTACAG - UNI34060 - ATATCTCCACAGGACCTTCTTGGTTAA

ATCAGGGACTACTTTTGAACTCTACCCAATCAGTTTCAAATTTAGACCCGACCACCGGTGCCACTGTACCCCAATCAAG TGTAAACCAAGGGTTGTGCT

TGGATGCTGAAGTGGCCTTAGCAACTGGGCAGCTCCCTGCCTCAAACAGTCACCAGTCCAGCAGTGCAGCCTCTCACTTCTCGGAGTCCCGCGGCGAGAC

CCCCTGTTCATTCAACGATGAAGATGAGGAAGATGAAGAGGAGGATCCCTCCTCCCCAGAATAAAGACAGGAGAGAACTCATGTTTTAATATTTGATGCT

CATATGTGTCTTTAGTGTGAGCTCTTGTGTTTTGAAATGATTGCTTCAGTCTTTGCCTTTGTTTGCATTTGTGTTTAGTGAAAACTAGAGAAACACAATA

AGCAAATCACTTGAAGGCTGAGATGATTGAACTGAAAGTTCCCATAGCGTGGATGAAACCGAGCAGCAGAGCAGCAGGACATGGCCAACAAAGCGTGCTT

TCTGAGGACGTGGAGAGTGGCAGTGACGAAGGTCATTTGTTTTCAGGGAGGTAGGGTTTAAAGACCCCCAGTGGGAGCATTTAGATGGCAGGCGGCTGCA

AGGAGTCTGCAGTGGTAACAGCTTCTCTCTAGCCTGGCTGGCTTTGGTAGGCAAAAGTGAACTTGGAAGTCACAGTGGGATCAGAGGGGTGTAGGTTGCG

ATCCTTGTCGCCTGAGGAGCCGGTGGACTGCTGAGCTAGTCCAGGGGTAGCCGGTCCCCTCATGCATCTGCTGCCTTAGCTTCTAGAACGGAGCAAGCTT

TTACGTACCTAGGTGACATGTAGAAAAATTTACAGTAAACTGAAATGACCATTTGTCAATGCATTGGTGCATAGGAGTTACTAGGGCTACTTCTGGAAGC

CAAAATAGAATAGCATCTCCATGTGCATTAAAAACTTCGCCAGCACTGCCTTTTGCCAGCATTCTAAATTTGGAGTTTTACTGAGAAGGAAACTGTTTTT

ATAGTTTTAATCAGAGCTATGCATTTCATACAGCTTTTTAATTTACAATGAAACAAAGAAACAAATTCCTTTGACCAAATTGCTTGTCTATAGTTGTCTG

CAGTACTGTATGATTTTACCCATGTGCAATTTGTAAAATGAACCAGATGTCACTACTTTTGTCTTTATTTCAAGAATATGGCCATCACTGTTCTCTTATA

CATGTTCTTTTCCATATTTTAATTATCAAAATGACCATATCAGACTTATTCCTGGGTAAATTGCATTTCAAACT
Translation
 - UNI20472 -  - UNI11446 -  - UNI10407 -  - UNI13152 - M - UNI2193 - IISTPQRIANSGSVLIGNPYTPAPAMVTQT

HIAEAAGWVPS - UNI20435 - SDRKRAREFIDSDFSES - UNI18015 - SKRSKKGDKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVSEF

TNSNNHLAADS - UNI1075 - AYDQKNIRRRVYDALNVLMAMNIISKEKKEIKWIGLPTNSAQECQNLE IEKQRRIERIKQKRAQLQELLLQ QIA

FKNLVQRNRQNEQQNQGPPAVNSTIQLPFIIINTSRKTVIDCSISSDK KFEYLFNFDNTFEIHDDIEVLKRMGMSFGLESGKCSLEDLKIAKSLVPKAL

EGYITD - UNI34060 - DISTGPSWLNQGLLLNSTQSVSNLDPTTGATVPQSS SVNQGLCLDAEVALATGQLPASNSHQSSSAASHFSESRGETPC

SFNDEDEEDEEEDPSSPE

For any suggestions or comments, please send an email to unitrap@crg.es