Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032431 (Crtap)
Chromosomal location
Chr 9: 114284262 - 114299785 (-)
Description
cartilage associated protein Gene [Source:MGI Symbol;Acc:MGI:1891221]
RefSeq_dna
NM_019922 
RefSeq_peptide
NP_064306.1 
UniGene
Mm.20904 
MGI
MGI:1891221 
Uniprot/SWISSPROT
Q9CYD3 
Uniprot/SPTREMBL
Q8C8C5 
Human Ortholog
ENSG00000170275 (CRTAP)
Omim 610682 - OSTEOGENESIS IMPERFECTA, TYPE VII  610854 - OSTEOGENESIS IMPERFECTA, TYPE IIB  
UniTrap UNI11724
Vector Insertion
Chr 9: 114289174 - 114290703
Public Clones G063G12 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21624
Vector Insertion
Chr 9: 114287242 - 114289027
Public Clones not available
Private Clones OST323620 (lexicon)
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000084881
Sequence
GCCTCCCTTCCTAGGCCTGCCGCGTCGCGCGTCCTCAGCTCGGGGCTCTGGTTCGTGGGCCACGCGCGATGGGGCCCCGCAGCCCTACGGCCGCGTTGCT

GGTGCTGCTGTGTGTCGGGTGCGCGCCGACCCCCGGGCGCGGGCAGTACGAGCGCTACAGCTTCCGCAGCTTCCCGCGGGACGAGCTGATGCCGCTCGAG

TCGGCCTACCGCCACGCGCTCGACCAGTACAGCGGCGAGCACTGGGCCGAGAGCGTGGGCTACCTGGAGGTGAGCCTGCGGCTGCACCGTCTGCTGCGCG

ACAGCGAGGCCTTCTGCCACCGCAACTGCAGCGCGGCCACGCCAGCACCCGCGCCCGCCGGCCCGGCCAGCCACGCCGAACTACGCCTCTTCGGCAGCGT

GCTGCGCCGCGCGCAGTGCCTCAAGCGCTGCAAGCAGGGCCTGCCCGCCTTCCGCCAGTCGCAGCCCAGCCGCTCAGTGCTGGCGGACTTTCAGCAGCGC

GAGCCCTACAAGTTTCTGCAGTTCGCCTACTTCAAG GCCAATGACCTCCCGAAGGCCATCGCTGCGGCTCACACCTATCTCCTGAAGCATCCAGATGAC

GAGATGATGAAGAGAAACATGGAGTATTATAAGAGCTTGCCTGGAGCCGAGGACCACATTAAAGACTTGGAAACCAAGTCGTACGAG AGCCTGTTTGTC

CGTGCGGTGCGGGCCTACAACGGGGAGAACTGGAGAACGTCCATTTCCGACATGGAGCTCGCGCTTCCCGACTTCCTCAAGGCCTTCTACGAGTGCCTGG

CTGCCTGCGAGGGGTCGCGGGAGATCAAGGACTTCAAGGACTTCTACCTGTCCATAGCAG ATCACTATGTGGAAGTTCTGGAGTGTAAGATTCGTTGTG

AGGAGACCCTCACCCCAGTCATAGGAGGCTATCCCGTGGAGAAATTTGTGGCGACCATGTACCACTATTTACAGTTTGCGTATTACAAGT - UNI1172

4 - TGAATGATCTGAAGAATGCAGCCCCGTGTGCCGTCAGCTACCTGCTCTTTGACCAGAGTGACAGGGTCATGCAACAGAACCTGGTGTACTATCAGT

ACCACCGGGACAAGTGGGGCCTCTCGGATGAGCACTTCCAGCCCAGACCC - UNI21624 - GAAGCAGTTCAGTTCTTTAATGTGACGACGCTCCAG

AAGGAACTGTACGACTTCGCTCAGGAACACCTAATGGATGACGATGAG GGAGAGGTTGTGGAGTATGTGGACGACTTGTTGGAGACGGAAGAGTCTGCC

TAGTCCACAGGGGCTAAGGAACCTCTCTTCCGAGTTCCTCTTTCTTCAAGTGCCTGGGTTGTTGATACCTCACAGCCTTTTCTTCTTAAAGTAAGAAGGA

AGCCACCATCTCTCCCTACCAAGGTCAAGCCTGACTTCCCCTTGTTCACACTCAGTATTCACGCTTGTCTTCATGGTTACACGTCTTCATGCCTGTCTTT

CCCTTCACACATGTGTTCCCGTCATCTAGTCTGTCCTCCTCAAAGTCACGTTCGTCTCCCCTCTGATCCCATGTGTCTCCCCCATGTTCAGAAAGACAGT

CTTCTGTGGTCTGCTTTCTCATCCCTGAAGAAAAATCAGTATTATTTTTTAAGTAAGAAAAACACTAAAAGATGATAAATATATTTGG
Translation
MGPRSPTAALLVLLCVGCAPTPGRGQYERYSFRSFPRDELMPLESAYRHALDQYSGEHWAESVGYLEVSLRLHRLLRDSEAFCHRNCSAATPAPAPAGPA

SHAELRLFGSVLRRAQCLKRCKQGLPAFRQSQPSRSVLADFQQREPYKFLQFAYFK ANDLPKAIAAAHTYLLKHPDDEMMKRNMEYYKSLPGAEDHIKD

LETKSYE SLFVRAVRAYNGENWRTSISDMELALPDFLKAFYECLAACEGSREIKDFKDFYLSIAD DHYVEVLECKIRCEETLTPVIGGYPVEKFVATM

YHYLQFAYYKL - UNI11724 - LNDLKNAAPCAVSYLLFDQSDRVMQQNLVYYQYHRDKWGLSDEHFQPRP - UNI21624 - EAVQFFNVTTLQ

KELYDFAQEHLMDDDE GEVVEYVDDLLETEESA

For any suggestions or comments, please send an email to unitrap@crg.es