Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032437 (Stt3b)
Chromosomal location
Chr 9: 115152921 - 115219586 (-)
Description
STT3, subunit of the oligosaccharyltransferase complex, homolog B (S. cerevisiae) Gene [Source:MGI Symbol;Acc:MGI:1915542]
RefSeq_dna
NM_024222 
RefSeq_peptide
NP_077184.2 
UniGene
Mm.296158 
MGI
MGI:1915542 
Uniprot/SWISSPROT
Q3TDQ1 
Uniprot/SPTREMBL
Q8BGU3 
Human Ortholog
ENSG00000163527 (STT3B)
Omim not available
UniTrap UNI19051
Vector Insertion
Chr 9: 115189638 - 115218869
Public Clones not available
Private Clones OST406142 (lexicon) OST325639 (lexicon) OST325637 (lexicon) OST218444 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12541
Vector Insertion
Chr 9: 115176494 - 115185821
Public Clones W046A02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4806
Vector Insertion
Chr 9: 115161805 - 115162950
Public Clones AR0465 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035010
Sequence
GTGCTCCTCGCGGCTGGGCGGGCGGGGGAATGTCATTGCCGCTCCGAGCCGCCGCTCCTCTGGCGCCCTCGTCCCGTCGGCTCTCGCCGCCACCGCCGCC

TCCTCAGCCGCACGGGGGACACGGATGGCTAGTGGGGCGCAGGGGCCTTTTGGGTTGAGACCGCGACGGTCGCGGCCACTGTTGAGGCGGAGACTTCGGA

TCGCTGCCGCCTCCACCACCCCCAGTGTCCCGGCCTCGCGGTGCTGAGGGCGGGAGCGCGCCCAGCTCTTCCTCCGCCTCCGCCTCCTCCTCCTCCTCGT

TGTCGTCGCCGTCGCCCTCCTCCTCCTCCTCTGGGTCTCCGCCCAGCACCCCTCGCTCCAGGCGGCGGCGGTGGCCGCGGAGGACGAGCGAGACCCGCCG

CCGGGGCACAACATGGCGGAGCCCTCGGCCCCGGAGAGCAAGCACAAGTCGTCCCTCAACTCGTCCCCGTGGAGCGGCCTCATGGCTCTGGGGAACAGCC

GCCACGGGCACCATGGGCCCGGAACCCAGAGCGCGTCCAGGGCGGCGGCGCCGAAGCCGGGGCCCCCCGCGGGGCTGTCCGGGGGCTTGTCGCAGCCGGC

CGGGTGGCAGTCGTTGCTCTCCTTCACCATCCTCTTCCTGGCCTGGCTGGCCGGCTTCAGCTCGCGCCTCTTCGCCGTCATCCGCTTCGAGAGCATCATC

CACGAGTTCGACCCGTG - UNI19051 - GTTTAACTATAGATCAACACATCATCTTGCATCTCATGGATTCTATGAGTTTCTAAATTGGTTTGATGA

AAGAGCATGGTACCCACTGGGAAGAATAGTGGGTGGCACC GTTTACCCAGGGTTGATGATAACAGCTGGCCTTATTCATTGGATTTTAAATACATTGAA

CATAACAGTTCACATAAGAGATGTGTGTGTATTCCTTGCACCAACTTTTAGCGGCCTTACATCCATATCTACGTTCCTGCTAACTAGAGAACTGTGGAAC

CAAGGAGCAGGACTTCTAGCTGCTTGCTTCATTGCTATCGTACCAGGGTACATATCTCGGTCAGTGGCGGGATCCTTTGATAATGAAGGCATTGCCATTT

TTGCGCTTCAGTTCACTTACTACTTATGG - UNI12541 - GTAAAGTCTGTGAAGACCGGGTCTGTGTTCTGGACAATGTGCTGCTGCTTGTCATAT

TTCTACATG GTCTCTGCGTGGGGAGGTTATGTGTTCATCATCAACCTCATCCCTCTCCATGTGTTTGTGTTGCTGCTGATGCAGAGGTACAGCAAGAGA

GTCTACATAG CATATAGCACTTTCTACATTGTGGGTTTAATATTATCCATGCAGATACCTTTTGTGGGATTTCAGCCAATCAGAACAAGCGAGCACATG

GCAGCTGCAG GTGTCTTTGCGCTGCTGCAAGCTTACGCTTTTTTGCAGTATCTGAGAGACCGGTTGACAAAACAGGAGTTCCAGACCCTTTTCTTTTTG

GGTGTCTCACTAGCTGCAGGCGCTGTGTTCCTTAGTGTCATCTATCTGACATACACAG GTTATATTGCACCATGGAGTGGCAGGTTTTATTCACTATGG

GATACTGG GTATGCAAAAATACACATTCCAATTATTGCATCAGTGTCTGAACATCAGCCTACGACATGGGTGTCTTTCTTCTTTGATCTACATATTCTT

GTATGTACCTTCCCAGCAGGCCTATGGTTCTGCATCAAAAATATCAACGATGAAAGAGTATTTG TCGCTCTGTATGCGATCAGTGCTGTCTACTTTGCC

GGAGTGATGGTGCGGCTGATGCTGACTCTGACCCCGGTCGTCTGCATGCTGTCGGCCATCGCCTTCTCCAATGTTTTTGAGCACTATTTGGGGGATGACA

TGAAAAGGGAAAACCCACCTGTGGAGGACAGCAGTGATGAGGATGACAAAAGAAACCCAGGAAACTTGTATGACAAG - UNI4806 - GCAGGTAAAG

TGAGGAAGCATGTGACAGAGCAAGAGAAACCTGAAGAGGGCTTGGGCCCCAACATCAAAAGCATTGTGACCATGCTGATGCTCATGCTCCTGATGATGTT

CGCGGTCCACTGCACGTGGGTCACAAGCAACGCCTACTCCAGTCCAAGTGTGGTCCTTGCCTCCTACAATCATGATGG TACCAGGAATATATTAGATGA

TTTTAGAGAAGCGTACTTTTGGCTGAGACAAAACACGGATGAACACGCCCGGGTCATGTCGTGGTGGGACTACGGCTATCAGATTGCTGGCATGGCCAAC

AGGACCACTCTGGTGGATAACAACACCTGGAACAACAGCCACATCGCACTG GTCGGAAAAGCTATGTCTTCCAATGAAACGGCCGCCTATAAAATCATG

AGGTCCCTTGATGTCGATTATGTGTTGGTTATTTTCGGAGGAGTGATTGGCTATTCCGGGGACGATATCAACAAGTTCCTCTGGATGGTCAGGATAGCTG

AAGGGGAGCATCCCAAAGACATCCGG GAAGGTGACTATTTCACCCAGCAGGGAGAGTTCCGAGTAGACAAAGCTGGGTCTCCTACTCTGTTAAACTGCC

TTATGTATAAAATGTCATACTACAGATTTGGAGAAATGCAG CTAGATTTTCGCACTCCCCCAGGCTTTGACCGAACACGTAATGCTGAGATTGGAAATA

AAGACATTAAATTCAAGCATTTGGAGGAAGCTTTTACATCAGAGCACTGGCTTGTCAGGATATATAAAGTGAAAGCACCTGACAACAGGGAGACACTAGG

TCACAAACCTCGAGTCACCAACATCGTCCCCAAACAGAAGTATTTGTCAAAGAAG ACTACTAAAAGGAAGCGTGGCTACGTTAAAAATAAGCTAGTGTT

TAAGAAAGGCAAGAAGACCTCTAAGAAGACTGTTTAAATGCGCTGTTCTGGCCTCACTTGCAGCAGTCCTTGAGAGAACCGGTCTTTGCCTTCTGCTCAT

GTCCTGTTTCACAGCACCAAGGGTACAGAACATCGCTGGGCCAAGTCAATGTACAAAATGTTCTGGCAATGCCTCATTTAAAATTAAATTGGTTTATTG
Translation
MAEPSAPESKHKSSLNSSPWSGLMALGNSRHGHHGPGTQSASRAAAPKPGPPAGLSGGLSQPAGWQSLLSFTILFLAWLAGFSSRLFAVIRFESIIHEFD

PW - UNI19051 - WFNYRSTHHLASHGFYEFLNWFDERAWYPLGRIVGGT VYPGLMITAGLIHWILNTLNITVHIRDVCVFLAPTFSGLTSISTFL

LTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLW - UNI12541 - VKSVKTGSVFWTMCCCLSYFYM VSAWGGYVFIINL

IPLHVFVLLLMQRYSKRVYIA AYSTFYIVGLILSMQIPFVGFQPIRTSEHMAAAG GVFALLQAYAFLQYLRDRLTKQEFQTLFFLGVSLAAGAVFLSV

IYLTYTG GYIAPWSGRFYSLWDTG GYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFV VALYAISAVYFAGVMVRLML

TLTPVVCMLSAIAFSNVFEHYLGDDMKRENPPVEDSSDEDDKRNPGNLYDK - UNI4806 - AGKVRKHVTEQEKPEEGLGPNIKSIVTMLMLMLLMM

FAVHCTWVTSNAYSSPSVVLASYNHDG GTRNILDDFREAYFWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIAL VGKAMSSNETAAY

KIMRSLDVDYVLVIFGGVIGYSGDDINKFLWMVRIAEGEHPKDIR EGDYFTQQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQ LDFRTPPGFDRTRNA

EIGNKDIKFKHLEEAFTSEHWLVRIYKVKAPDNRETLGHKPRVTNIVPKQKYLSKK TTKRKRGYVKNKLVFKKGKKTSKKTV

For any suggestions or comments, please send an email to unitrap@crg.es