Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032449 (Slc25a36)
Chromosomal location
Chr 9: 96978166 - 97011576 (-)
Description
solute carrier family 25, member 36 Gene [Source:MGI (curated);Acc:Slc25a36-001]
RefSeq_dna
NM_138756 
RefSeq_peptide
NP_620095.1 
UniGene
Mm.228067 
MGI
MGI:1924909 
Uniprot/SWISSPROT
Q922G0 
Uniprot/SPTREMBL
Q8BZJ4 Q99KM7 
Human Ortholog
ENSG00000114120 (SLC25A36)
Omim not available
UniTrap UNI10738
Vector Insertion
Chr 9: 97000659 - 97011329
Public Clones (sanger) P111E05 (ggtc) P144G07 (ggtc) P116D03 (ggtc) E039H11 (ggtc)
D098D06 (ggtc) D036C04 (ggtc) D028F03 (ggtc) P078B02 (ggtc) P132H06 (ggtc)
P099G12 (ggtc) D143H12 (ggtc) D075F05 (ggtc) D033C12 (ggtc) P066G08 (ggtc)
P117E05 (ggtc) E088A08 (ggtc) D127B06 (ggtc) D042E02 (ggtc) D028G10 (ggtc)
P068B01 (ggtc) P101D11 (ggtc) E038H08 (ggtc) D080H08 (ggtc) D035A02 (ggtc)
Q017C06 (ggtc) P124C02 (ggtc) P099F11 (ggtc) D137F12 (ggtc) D042E05 (ggtc)
P147G01 (ggtc) P079H11 (ggtc) D144F06 (ggtc) D034E02 (ggtc) W268F02 (ggtc)
P120A01 (ggtc) D029E04 (ggtc) CMHD-GT_319C07-3 (cmhd) PST24296-NR (escells)
IST14194E3 (tigm) IST14788E3 (tigm) IST14207F2 (tigm) IST13201A5 (tigm)
IST14499B5 (tigm) IST14954E5 (tigm) IST14244H1 (tigm) IST14468E9 (tigm)
IST13458D12 (tigm) IST14561F9 (tigm) IST10126C2 (tigm) IST13215E6 (tigm)
IST11618B5 (tigm) IST14215A11 (tigm) IST13599D5 (tigm) IST14179C1 (tigm)
IST13443G4 (tigm) IST14571E2 (tigm) IST14428C12 (tigm) IST14135F10 (tigm)
IST14814B11 (tigm) IST10726E4 (tigm) IST14246A4 (tigm) IST14216F3 (tigm)
IST14207C3 (tigm)
Private Clones OST452423 (lexicon) OST449885 (lexicon) OST447517 (lexicon) OST444982 (lexicon)
OST434597 (lexicon) OST425548 (lexicon) OST413805 (lexicon) OST403540 (lexicon)
OST403471 (lexicon) OST381772 (lexicon) OST380929 (lexicon) OST379658 (lexicon)
OST373038 (lexicon) OST368951 (lexicon) OST328159 (lexicon) OST328129 (lexicon)
OST320410 (lexicon) OST315835 (lexicon) OST315003 (lexicon) OST309776 (lexicon)
OST303745 (lexicon) OST302415 (lexicon) OST295640 (lexicon) OST295511 (lexicon)
OST294808 (lexicon) OST293065 (lexicon) OST292079 (lexicon) OST283818 (lexicon)
OST281428 (lexicon) OST268916 (lexicon) OST261792 (lexicon) OST259245 (lexicon)
OST257845 (lexicon) OST251876 (lexicon) OST250674 (lexicon) OST240339 (lexicon)
OST238253 (lexicon) OST238160 (lexicon) OST233353 (lexicon) OST232859 (lexicon)
OST232788 (lexicon) OST230827 (lexicon) OST225053 (lexicon) OST202434 (lexicon)
OST201268 (lexicon) OST198580 (lexicon) OST195067 (lexicon) OST188098 (lexicon)
OST186147 (lexicon) OST185441 (lexicon) OST183782 (lexicon) OST183714 (lexicon)
OST183338 (lexicon) OST181158 (lexicon) OST180877 (lexicon) OST180455 (lexicon)
OST177582 (lexicon) OST174277 (lexicon) OST174232 (lexicon) OST171867 (lexicon)
OST171263 (lexicon) OST171077 (lexicon) OST169427 (lexicon) OST167307 (lexicon)
OST166198 (lexicon) OST150619 (lexicon) OST149444 (lexicon) OST148175 (lexicon)
OST144551 (lexicon) OST140981 (lexicon) OST136150 (lexicon) OST136143 (lexicon)
OST131021 (lexicon) OST122675 (lexicon) OST115754 (lexicon) OST115394 (lexicon)
OST105637 (lexicon) OST102559 (lexicon) OST90360 (lexicon) OST90190 (lexicon)
OST90152 (lexicon) OST79937 (lexicon) OST62234 (lexicon) OST56349 (lexicon)
OST56085 (lexicon) OST36235 (lexicon) OST35990 (lexicon) OST34776 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10856
Vector Insertion
Chr 9: 96997600 - 97000493
Public Clones D010E05 (ggtc) 3SE152A04 (ggtc) D026E11 (ggtc)
Private Clones OST366439 (lexicon) OST331856 (lexicon) OST225567 (lexicon) OST196976 (lexicon)
OST168686 (lexicon) OST146033 (lexicon) OST139277 (lexicon) OST81995 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16249
Vector Insertion
Chr 9: 96993597 - 96997521
Public Clones (sanger)
Private Clones OST464533 (lexicon) OST367802 (lexicon) OST220855 (lexicon) OST208248 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17595
Vector Insertion
Chr 9: 96980902 - 96984811
Public Clones not available
Private Clones OST440015 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11045
Vector Insertion
Chr 9: 96979659 - 96980611
Public Clones W094E04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035024
Sequence
ATGAGTTTCTTTAGGATTATTTCCAGAAGCCATGG - UNI17595 - GACTCGTGGGGAAAAGCAAATGGGTGCTTTTGAATGTGTTCGTAAAGTCTA

TCAGACAGACGGACTGCGAGGATTTTATAGGGGCATGTCTGCCTCCTATGCCGGCATATCAGAGACTGTTATCCATTTTGTTATTTATGAAAGTATAAAG

CAAAAACTACTGGAATGTAAGACTGCTTCTATGATGGAAACTGATGAGGAGTCTGTGAAAGAAGCATCGGATTTTGTGAGAATGATGCTAGCTGCTGCCA

CCTCAAAAACCTGTGCCACAACCATAGCGTATCCACACG - UNI11045 - AAGTTGTAAGAACAAGACTACGTGAAGAAGGGACAAAATATAGGTCT

TTTTTTCAAACATTGTCTTTGATTGTTCAAGAAGAAGGCTATGGATCTCTTTACCGCGGTCTAACAACTCATCTGGTGAGGCAGATTCCAAACACGGCCA

TTATGATGGCCACCTACGAACTGGTGGTCTACCTTCTCAACGGATAGCAGCAAGGGCTGCCATACTGCAGAGCAGGAAGACCAAAAGATCACAGTGGACC

ATGGAATCTTGAAGCCAGCCAGCATGGTGGACAGAAGACAGTAGTTGGGAAACATGTAACTACTATGGCTGAGTGGAAGTTTGGTTTTAGGAAGTAAGGT

ACCATACGACATTAATCTTTCAGTGAGTAAACCCTGGGCCGCCTCGTCAAGAATGCTTTGAAAAGCATTCCTTTCTCAAAATTGCCATTTTCTCTATTGT

TCACCAGCTCCAGTTTGTTTTACTGGTTTATGACATTCAGAATACAGTGTTGATTCCATGAGCATTTTTGGTTGTTTAAACAAAATCATTCCTAAGTGTA

TACTGTACTGTAATTTTCCAAAGATGGTAGTGACAATTACAAATGACTAACTTGAACGTCTGCAATACTGTAAAATAACAAGTCGATCCTCAGTAACACT

TCCCCAGGAGGGCCTGCCTGTTACAGTGTTTTATGTTATCTGACACCCATAATCACTGTATTTTGACAGCCAGTGAAGTAGTATCTAAATACTTCACATT

TTCAACATCAAAATGTTATGGTCACATCTAAAAGATCTCCATCATAATTGAACATATCAAACAAACACACACAGCTAATGGTTTGGGACTATAAAATAAG

CTAGTGGATACTGACTCAGTGACTTAGCATCCTCATACCTTTTCCAATTATGTGATGCAGGTATGGATATAATTTTGATTCATAATGTGATTATCACAGT

CTCATACCTACATATTATTTACTTTAAAAGTAGAAAACTAACAACTTGAATTTTTTCTACTTACTTTCACATTAAGAATTTTAACCTTTGAATTATTTCC

ACATCTGTATAAGTTATTCTTTGTTGGTAGAGGAAATGGTAATTTTCAGTTTTGCCCTTTATAGGCTCCTTGAAGTGATATTAATATTTAGGACAATATA

AATATTACAAAAAGACACGCTCAGCTATCAGATACAATAAATCTTAGTTGGCAGAGAGCCTGTAAGCGAGTGTGCTACATTGCACAAATGTTATTCCTAG

TTCCCTAAATGCTCTCTCATAGAGTCAGGCTAGTTTTAGTTCATTGTGTTAACAAGATAATAGTTTTTAAATTTTGCTGTTGAGTCAACAACATGTTTGA

ATACTTTAATATATATGGCCATTATAAAGGTATTTGCTGCAATACTATAGATTTTCCTATGGATGTTGCTATACTGGCATATGAAACGTCTACAATTAAA

CTCTAGTGTGGTGCTCATCAGAGGACCTTCACTTTACACTTTGTGC
Translation
MSFFRIISRSHG - UNI17595 - GTRGEKQMGAFECVRKVYQTDGLRGFYRGMSASYAGISETVIHFVIYESIKQKLLECKTASMMETDEESVKEAS

DFVRMMLAAATSKTCATTIAYPHE - UNI11045 - EVVRTRLREEGTKYRSFFQTLSLIVQEEGYGSLYRGLTTHLVRQIPNTAIMMATYELVVYLL

NG
Transcript ENSMUST00000085206
Sequence
GACCTCCGACTCCTCACGACTCTCACTGCGCAGTCCGACGGAGCTCGCTGGAGCAGGAACCCCGTGGGGTGGGTTCGCGGGTGGCCTTCCGCAGCGGCGG

CTCCGCCCACTCCCTTGCGTCCCCCTTCTTGGCCCTCGCCGCTGGCCGTGGCGGCCTGCTGGGTCCGCGTCCCGCCTCTACTCCCGGAGGACATGCAGAA

GAGAGAATGAGCCAGAGGGACACGCTGGTGCATCTGTTTGCCGGGGG - UNI10738 - ATGTGGTGGCACAGTGGGAGCTATTCTGACATGTCCACT

GGAAGTTGTCAAAACACGGCTGCAGTCTTCTTCTGTGACACTGTATATTTCTGAAGTTCAGCTGAACACCATGGCTGGAGCCAGTGTGAACCGAGTAGTG

TCCCCTGGACCTCTTCATTGTCTGAA - UNI10856 - GGCTATCCTGGAAAAAGAGGGCCCTCGCTCGTTGTTTAGAGGATTGGGCCCCAATTTGGT

GGGGGTTGCTCCCTCCAG - UNI16249 - AGCAATATACTTTGCTGCTTATTCAAACTGCAAGGAAAAGTTGAATGGTGTTTTTGATCCTGATTCTA

CCCAAGTGCACATGGCTTCAGCTGCAATGGCAG GTTTTACTGCAATCACTGCAACAAACCCCATTTGGCTTATAAAGACTCGCTTACAGCTTGATGCAA

G - UNI17595 - GACTCGTGGGGAAAAGCAAATGGGTGCTTTTGAATGTGTTCGTAAAGTCTATCAGACAGACGGACTGCGAGGATTTTATAGGGGC

ATGTCTGCCTCCTATGCCGGCATATCAGAGACTGTTATCCATTTTGTTATTTATGAAAGTATAAAGCAAAAACTACTGGAATGTAAGACTGCTTCTATGA

TGGAAACTGATGAGGAGTCTGTGAAAGAAGCATCGGATTTTGTGAGAATGATGCTAGCTGCTGCCACCTCAAAAACCTGTGCCACAACCATAGCGTATCC

ACACG - UNI11045 - AAGTTGTAAGAACAAGACTACGTGAAGAAGGGACAAAATATAGGTCTTTTTTTCAAACATTGTCTTTGATTGTTCAAGAAG

AAGGCTATGGATCTCTTTACCGCGGTCTAACAACTCATCTGGTGAGGCAGATTCCAAACACGGCCATTATGATGGCCACCTACGAACTGGTGGTCTACCT

TCTCAACGGATAGCAGCAAGGGCTGCCATACTGCAGAGCAGGAAGACCAAAAGATCACAGTGGACCATGGAATCTTGAAGCCAGCCAGCATGGTGGACAG

AAGACAGTAGTTGGGAAACATGTAACTACTATGGCTGAGTGGAAGTTTGGTTTTAGGAAGTAAGGTACCATACGACATTAATCTTTCAGTGAGTAAACCC

TGGGCCGCCTCGTCAAGAATGCTTTGAAAAGCATTCCTTTCTCAAAATTGCCATTTTCTCTATTGTTCACCAGCTCCAGTTTGTTTTACTGGTTTATGAC

ATTCAGAATACAGTGTTGATTCCATGAGCATTTTTGGTTGTTTAAACAAAATCATTCCTAAGTGTATACTGTACTGTAATTTTCCAAAGATGGTAGTGAC

AATTACAAATGACTAACTTGAACGTCTGCAATACTGTAAAATAACAAGTCGATCCTCAGTAACACTTCCCCAGGAGGGCCTGCCTGTTACAGTGTTTTAT

GTTATCTGACACCCATAATCACTGTATTTTGACAGCCAGTGAAGTAGTATCTAAATACTTCACATTTTCAACATCAAAATGTTATGGTCACATCTAAAAG

ATCTCCATCATAATTGAACATATCAAACAAACACACACAGCTAATGGTTTGGGACTATAAAATAAGCTAGTGGATACTGACTCAGTGACTTAGCATCCTC

ATACCTTTTCCAATTATGTGATGCAGGTATGGATATAATTTTGATTCATAATGTGATTATCACAGTCTCATACCTACATATTATTTACTTTAAAAGTAGA

AAACTAACAACTTGAATTTTTTCTACTTACTTTCACATTAAGAATTTTAACCTTTGAATTATTTCCACATCTGTATAAGTTATTCTTTGTTGGTAGAGGA

AATGGTAATTTTCAGTTTTGCCCTTTATAGGCTCCTTGAAGTGATATTAATATTTAGGACAATATAAATATTACAAAAAGACACGCTCAGCTATCAGATA

CAATAAATCTTAGTTGGCAGAGAGCCTGTAAGCGAGTGTGCTACATTGCACAAATGTTATTCCTAGTTCCCTAAATGCTCTCTCATAGAGTCAGGCTAGT

TTTAGTTCATTGTGTTAACAAGATAATAGTTTTTAAATTTTGCTGTTGAGTCAACAACATGTTTGAATACTTTAATATATATGGCCATTATAAAGGTATT

TGCTGCAATACTATAGATTTTCCTATGGATGTTGCTATACTGGCATATGAAACGTCTACAATTAAACTCTAGTGTGGTGCTCATCAGAGGACCTTCACTT

TACACTTTGTGC
Translation
MSQRDTLVHLFAGG - UNI10738 - GCGGTVGAILTCPLEVVKTRLQSSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLK - UNI10856 - KA

ILEKEGPRSLFRGLGPNLVGVAPSR - UNI16249 - RAIYFAAYSNCKEKLNGVFDPDSTQVHMASAAMAG GFTAITATNPIWLIKTRLQLDAR -

 UNI17595 - RTRGEKQMGAFECVRKVYQTDGLRGFYRGMSASYAGISETVIHFVIYESIKQKLLECKTASMMETDEESVKEASDFVRMMLAAATSKT

CATTIAYPHE - UNI11045 - EVVRTRLREEGTKYRSFFQTLSLIVQEEGYGSLYRGLTTHLVRQIPNTAIMMATYELVVYLLNG

For any suggestions or comments, please send an email to unitrap@crg.es