Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032458 (Copb2)
Chromosomal location
Chr 9: 98464150 - 98488794 (+)
Description
coatomer protein complex, subunit beta 2 (beta prime) Gene [Source:MGI Symbol;Acc:MGI:1354962]
RefSeq_dna
NM_015827 
RefSeq_peptide
NP_056642.1 
UniGene
Mm.399418 Mm.400464 
MGI
MGI:1354962 
Uniprot/SWISSPROT
O55029 
Human Ortholog
ENSG00000184432 (COPB2)
Omim not available
UniTrap UNI27010
Vector Insertion
Chr 9: 98464243 - 98468411
Public Clones not available
Private Clones OST78984 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6150
Vector Insertion
Chr 9: 98474585 - 98477376
Public Clones CSG040 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035033
Sequence
AGTGGGTTGGCCGGTCCACGGGTCGGTGGGTTCCTGAGTGTGTCGCCTTGAGCCTGTGACGGGCAGGGGCTCGCTCGGACAGTCGGAGCCATG - UNI2

7010 - CCTCTTCGACTTGACATCAAGAGAAAGCTGACTGCTAGGTCTGACCGAGTTAAGAGCGTGGATTTGCATCCCACAGAGCCATGGATGTTGGCT

AGTCTTTACAATGGCAGTGTGTGTGTTTGGAATCATGAAACTCAG ACACTGGTGAAGACGTTTGAAGTATGTGATCTTCCTGTTCGAGCTGCAAAGTTT

GTCGCAAGGAAGAACTGGGTGGTGACAGGAGCA GACGATATGCAGATCAGAGTGTTCAATTATAACACCCTGGAGAGGGTGCATATGTTTGAAGCACAC

TCGGATTACATTCGTTGTATTGCTGTTCATCCCACCCAGCCGTTCATTCTCACCAGCAGTG ATGACATGCTTATTAAGCTCTGGGACTGGGATAAAAAA

TGGTCTTGTTCACAAGTGTTTGAAGGACACACGCACTACGTTATGCAGATTGTGATAAACCCCAAAGATAACAATCAGTTTGCCAGTGCATCTCTCGACA

GGACCATCAAG GTGTGGCAGCTGGGCTCCTCATCACCAAACTTCACTCTGGAAGGACATGAAAAAGGCGTGAATTGCATTGACTACTACAGTGGTGGTG

ACAAGCCATACCTCATTTCAGGTGCAGATGACCGGCTTGTTAAAATATGGGATTATCAG AACAAAACGTGTGTGCAGACCCTGGAGGGGCATGCCCAGA

ATGTGTCGTGTGCGAGCTTCCATCCTGAGCTGCCCATCATCATCACAGGGTCAGAAGACG - UNI6150 - GAACTGTGCGAATCTGGCATTCTAGCA

CCTACCGGCTTGAGAGCACGCTGAATTACGGAATGGAGAGGGTGTGGTGTGTGGCCAGTCTGAGAGGGTCCAACAATGTCGCTCTGGGCTATGATGAAGG

GAGCATCATTGTTAAG CTTGGTCGGGAGGAACCTGCCATGTCCATGGATGCCAATGGAAAGATAATCTGGGCCAAGCATTCAGAAGTCCAGCAGGCCAA

CCTGAAAGCAATGGGTGACACTGAGATTAAAGATGGAGAAAGATTGCCACTGGCAGTAAAGGACATGGGCAGTTGTGAAATATATCCACAGACCATTCAG

CACAATCCTAATGGGAG GTTTGTTGTGGTATGTGGTGATGGGGAGTATATCATCTACACAGCAATGGCATTGAGGAACAAGAGCTTCGGGTCTGCCCAG

GAGTTTGCATGGGCCCACGATTCTTCAGA GTATGCAATAAGAGAAAGCAACAGTATTGTAAAGATATTTAAAAACTTTAAGGAAAAAAAATCATTTAAA

CCCGATTTTGGAGCTGAAA GTATCTATGGGGGCTTCTTGCTGGGAGTCAGATCTGTAAATGGCTTAGCCTTCTATGACTGGGAGAATACTGAACTCATC

CGCAGAATTGAAATTCAGCCCAAGCAC ATCTTCTGGTCTGACTCTGGAGAGCTGGTCTGTATCGCCACCGAGGAGTCATTTTTTATTCTTAAATATCTG

TCAGAAAAAGTCTTGGCTGCACAGGAAACACATGAGGGAGTTACTGAAGATGGCATTGAAGACGCCTTTGAG GTTCTTGGTGAAATTCAGGAAATTGTG

AAAACTGGGCTGTGGGTAGGTGACTGCTTCATTTACACAAGTTCTGTGAACAGATTAAACTATTACGTGGGAGGAGAGATAGTCACCATCGCCCACCTGG

ACAG GACAATGTATCTTCTGGGCTATATTCCAAAAGACAATAGACTTTATCTGGGGGATAAGGAATTGAATATTGTTAGCTACTCCCTGTTGGTTTCAG

TCCTGGAATACCAGACTGCTGTCATGCGGAGGGATTTTAGCATGGCGGATAAAGTCCTCCCTACCATCCCCAAAGAACAGAGGACCAGAGTTGCACACTT

TTTGGAAAAACAG GGCTTCAAGCAGCAAGCACTTACAGTATCCACAGATCCTGAACATCGTTTTGAGCTTGCTCTTCAACTTGGAGAGTTGAAAATTGC

TTACCAGTTAGCAGTGGAAGCAGAG TCGGAGCAGAAGTGGAAACAACTTGCTGAACTTGCCATTAGTAAATGTCAGTTCAGCCTAGCCCAGGAGTGTCT

GCACCATGCTCAGGATTATGGTGGTCTGCTGCTCTTGGCCACTGCTTCTGGAAATGCTAGTATGGTGAACAAGCTGGCAGAAGGTGCGGAGAGAGACGGC

AAAAATAACGTGGCATTCATGAGCTATTTTTTACAGGGCAA GCTTGATGCTTGCCTAGAGCTCTTGATCAGAACAGGAAGACTCCCAGAAGCTGCCTTC

CTGGCCCGAACTTACTTACCCAGTCAGGTCTCAAG GGTGGTGAAACTGTGGAGGGAGAATCTCTCAAAAGTCAACCAGAAAGCAGCAGAATCCCTTGCT

GATCCTACAGAGTATGAAAACCTTTTCCCTGGATTAAAAGAAGCCTTTGTTGTTGAAGAATGGGTGAAGGAGACACATGCGGATTTGTGGCCAGCCAAGC

AGTACCCTCTTGTCACG CCAAATGAAGAGAGAAATGTTATGGAAGAGGCAAAAGGCTTTCAGCCCTCAAGACCCACAGCCCAGCAG GAACCTGATGGA

AAACCTGCTTCTAGCCCAGTTATCATGGCCTCCCAAACTACCCACAAAGAAGAAAAG AGTTTACTAGAACTAGAAGTTGATTTGGATAACTTGGAATTA

GAGGATATTGACACAACAGACATTAATCTGGATGAAGATATTCTGGATGATTAAAGTTTGCCATTTACTGCAGTAAGAGATTATTATGGCATTTTCAAAT

CAATCACCATCCTGACCAGAACTTTGGAAATCCTTGATTTGCATATGTAAACAAGGGGGAACATAGCCACTTCATCTTCAGGAGTTGATGGGCAGCGTTT

AAGTTACTATGTTCTCCTTGGTAACTGAAACAGAAACTTGCTTTTTTTCATATTGTTACTAGATCACCCGTCATAAAATCTTTTGAATT
Translation
M - UNI27010 - PLRLDIKRKLTARSDRVKSVDLHPTEPWMLASLYNGSVCVWNHETQ TLVKTFEVCDLPVRAAKFVARKNWVVTGA DDMQIRVF

NYNTLERVHMFEAHSDYIRCIAVHPTQPFILTSSD DDMLIKLWDWDKKWSCSQVFEGHTHYVMQIVINPKDNNQFASASLDRTIK VWQLGSSSPNFTL

EGHEKGVNCIDYYSGGDKPYLISGADDRLVKIWDYQ NKTCVQTLEGHAQNVSCASFHPELPIIITGSEDG - UNI6150 - GTVRIWHSSTYRLEST

LNYGMERVWCVASLRGSNNVALGYDEGSIIVK LGREEPAMSMDANGKIIWAKHSEVQQANLKAMGDTEIKDGERLPLAVKDMGSCEIYPQTIQHNPNGR

 RFVVVCGDGEYIIYTAMALRNKSFGSAQEFAWAHDSSE EYAIRESNSIVKIFKNFKEKKSFKPDFGAES SIYGGFLLGVRSVNGLAFYDWENTELIR

RIEIQPKH IFWSDSGELVCIATEESFFILKYLSEKVLAAQETHEGVTEDGIEDAFE VLGEIQEIVKTGLWVGDCFIYTSSVNRLNYYVGGEIVTIAHL

DR RTMYLLGYIPKDNRLYLGDKELNIVSYSLLVSVLEYQTAVMRRDFSMADKVLPTIPKEQRTRVAHFLEKQ GFKQQALTVSTDPEHRFELALQLGEL

KIAYQLAVEAE SEQKWKQLAELAISKCQFSLAQECLHHAQDYGGLLLLATASGNASMVNKLAEGAERDGKNNVAFMSYFLQGK KLDACLELLIRTGRL

PEAAFLARTYLPSQVSR RVVKLWRENLSKVNQKAAESLADPTEYENLFPGLKEAFVVEEWVKETHADLWPAKQYPLVT PNEERNVMEEAKGFQPSRPT

AQQ EPDGKPASSPVIMASQTTHKEEK SLLELEVDLDNLELEDIDTTDINLDEDILDD

For any suggestions or comments, please send an email to unitrap@crg.es