Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032463 (Faim)
Chromosomal location
Chr 9: 98886792 - 98902437 (+)
Description
Fas apoptotic inhibitory molecule Gene [Source:MGI Symbol;Acc:MGI:1344387]
RefSeq_dna
NM_011810 
RefSeq_peptide
NP_035940.3 NP_001116323.1 
MGI
MGI:1344387 
Uniprot/SWISSPROT
Q9WUD8 
Human Ortholog
ENSG00000158234 (FAIM)
Omim not available
UniTrap UNI22115
Vector Insertion
Chr 9: 98886932 - 98892519
Public Clones not available
Private Clones OST308087 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035038
Sequence
AGTGGGCGGGGTCTCGTTGAGCCCGGAAGGCAGTAGGAGGCTGGGCGCCCGGCATGCGGGTGCTGGAGCCCGGTGGGCGCGGCCGCGAGAGCTGCTGACT

ACGTCGTGGGATCGGGAGCCGGTGGCGGCGCGCGGAGCAG - UNI22115 - CCCTCTCTATAGCCTGGAAAAAATGACGGATCTCGTAGCTGTTTGG

GACGTAGCATTAAGTGACGGAGTCCACAAGATTGAATTTGAACATGGGACCACATCAGGCAAGCGGGTTGTGTACGTGGATGGGAAG GAAGAGATAAGA

AGAGAGTGGATGTTCAAGTTGGTGGGCAAAGAAACGTTCTTTGTCGGAGCTGCAAAAACCAAAGCCACCATCAATATAGATGCCATAAGTGGCTTCGCAT

ACGAGTACACGCTGGAAATTGATGGGAAGAGCCTCAAGAAGTACATGGAGAACAGGTCAAAGACCACCAGCACCTGGGTGCTGCGCCTGGATGGCGAGGA

CCTGAGAGTTGTTTTGG AAAAAGACACTATGGACGTATGGTGCAATGGTCAGAAAATGGAGACAGCG GGCGAGTTTGTAGATGATGGGACTGAGACGC

ACTTCAGCGTTGGGAACCACGGCTGTTACATAAAAGCTGTGAGCAGCGGAAAGAGGAAAGAAGGGATTATCCATACCCTCATTGTGGATAACAGGGAAAT

CCCAGAGCTCACTCAGTGACACCTTCTTACTGAGTTCTGAGCCGAGGAGGTGACCTCGGGACTCGCCGATGGCTGTGGTAATTAAATGGGTTCAATATGT

ACATATTGTTAGATTTAGTCTGCAATGTTTTTATTTTTATCTTTTGTTACTTGAAACTGTAATATTCCAATGGTCAAGAAAAAACAAGGACTCATAAAAA

TGTATTTTTTAACTAATATAAAGTGTTTCTAATTCAAATGGAAAATAAAATGTGGACCAAACCACTAACATCCCACAACAGTAACCTTGACTGTAGTTAA

CACTGTAAAATAAAATGGTGCTGCTGGCCCTGC
Translation
 - UNI22115 - MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGK EEIRREWMFKLVGKETFFVGAAKTKATINIDAISGFAYEYTLEIDGKS

LKKYMENRSKTTSTWVLRLDGEDLRVVLE EKDTMDVWCNGQKMETA GEFVDDGTETHFSVGNHGCYIKAVSSGKRKEGIIHTLIVDNREIPELTQ

For any suggestions or comments, please send an email to unitrap@crg.es