Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032470 (Mras)
Chromosomal location
Chr 9: 99287935 - 99337300 (-)
Description
muscle and microspikes RAS Gene [Source:MGI (curated);Acc:Mras-001]
RefSeq_dna
NM_008624 
RefSeq_peptide
NP_032650.1 
UniGene
Mm.2045 
MGI
MGI:1100856 
Uniprot/SWISSPROT
O08989 
Uniprot/SPTREMBL
Q3TPX5 
Human Ortholog
ENSG00000158186 (MRAS)
Omim not available
UniTrap UNI33103
Vector Insertion
Chr 9: 99326195 - 99336975
Public Clones (cmhd) IST14839F12 (tigm) IST12377A8 (tigm) IST11024E3 (tigm) IST12873D5 (tigm)
IST12416A9 (tigm) IST12000B11 (tigm) IST10212B1 (tigm) IST11024E2 (tigm)
IST12617B11 (tigm) IST11762E7 (tigm) IST15081G7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12825
Vector Insertion
Chr 9: 99312022 - 99326195
Public Clones (sanger) D079C12 (ggtc) D086G02 (ggtc) D188D02 (ggtc) D124C11 (ggtc)
CMHD-GT_280B2-3 (cmhd) CMHD-GT_523G4-3 (cmhd) CMHD-GT_351B11-3 (cmhd) CMHD-GT_297A10-3 (cmhd)
CMHD-GT_403F7-3 (cmhd) CMHD-GT_355C9-3 (cmhd) CMHD-GT_285A4-3 (cmhd) CMHD-GT_511E2-3 (cmhd)
CMHD-GT_372F5-3 (cmhd) CMHD-GT_355B9-3 (cmhd) FHCRC-GT-S5-7E1 (fhcrc) PST2576-NR (escells)
PST9192-NL (escells) IST11058G12 (tigm) IST11096H5 (tigm) IST11928A2 (tigm)
IST11537B11 (tigm) IST11150A12 (tigm) IST10199H12 (tigm) IST11101E11 (tigm)
IST10920G3 (tigm) IST14975A9 (tigm) IST11066B12 (tigm) IST11031D6 (tigm)
IST14678C9 (tigm) IST12409C10 (tigm) IST11576A4 (tigm) IST11637D1 (tigm)
IST10673B9 (tigm) IST11439H12 (tigm) IST11384G6 (tigm)
Private Clones OST453442 (lexicon) OST447375 (lexicon) OST442280 (lexicon) OST440639 (lexicon)
OST437639 (lexicon) OST425957 (lexicon) OST425663 (lexicon) OST396543 (lexicon)
OST391052 (lexicon) OST389585 (lexicon) OST369584 (lexicon) OST353774 (lexicon)
OST346738 (lexicon) OST333832 (lexicon) OST315257 (lexicon) OST310392 (lexicon)
OST300609 (lexicon) OST290282 (lexicon) OST285741 (lexicon) OST282158 (lexicon)
OST278655 (lexicon) OST271050 (lexicon) OST267363 (lexicon) OST254104 (lexicon)
OST250019 (lexicon) OST238432 (lexicon) OST226233 (lexicon) OST208997 (lexicon)
OST179598 (lexicon) OST172266 (lexicon) OST170724 (lexicon) OST164800 (lexicon)
OST149796 (lexicon) OST148479 (lexicon) OST148365 (lexicon) OST142244 (lexicon)
OST132438 (lexicon) OST132047 (lexicon) OST132015 (lexicon) OST128786 (lexicon)
OST126849 (lexicon) OST125473 (lexicon) OST123097 (lexicon) OST108223 (lexicon)
OST103835 (lexicon) OST90254 (lexicon) OST68089 (lexicon) OST66343 (lexicon)
OST59850 (lexicon) OST56298 (lexicon) OST47324 (lexicon) OST45655 (lexicon)
OST45418 (lexicon) OST42369 (lexicon) OST40884 (lexicon) OST38097 (lexicon)
OST34130 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5955
Vector Insertion
Chr 9: 99311811 - 99312022
Public Clones CSH312 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15940
Vector Insertion
Chr 9: 99295042 - 99311811
Public Clones IST12439B9 (tigm)
Private Clones OST469820 (lexicon) OST455087 (lexicon) OST358119 (lexicon) OST328906 (lexicon)
OST328902 (lexicon) OST328898 (lexicon) OST328890 (lexicon) OST278139 (lexicon)
OST246556 (lexicon) OST239945 (lexicon) OST193689 (lexicon) OST172762 (lexicon)
OST165731 (lexicon) OST138008 (lexicon) OST108319 (lexicon) OST63175 (lexicon)
OST58633 (lexicon) OST51261 (lexicon) OST37162 (lexicon)
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17585
Vector Insertion
Chr 9: 99290232 - 99293364
Public Clones not available
Private Clones OST440329 (lexicon) OST399771 (lexicon) OST351084 (lexicon) OST351083 (lexicon)
OST43267 (lexicon)
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000122384
Sequence
G - UNI5955 - - UNI12825 - - UNI33103 - GCCTGACTACCAGAAACATGGCGACCAGCGCTGTTCCAAGTGAAAACCTTCCCACATATA

AACTAGTAGTGGTGGGAGATGGTGGTGTGGGCAAGAGTGCGCTCACTATTCAGTTTTTCCAGAAGATCTTTGTGCCTGACTACGACCCCACCATTGAAGA

CTCCTACCTGAAGCATACAGAGATTGACAATCAGTGGGCCATCTTGGATG - UNI5955 - - UNI15940 - TTCTGGACACAGCCGGGCAGGAGG

AGTTCAGTGCCATGCGGGAACAATACATGCGCACAGGGGATGGCTTCCTCATTGTCTACTCCGTCACCGACAAGGCCAGCTTCGAGCACGTGGACCGCTT

CCACCAGCTCATTCTGCGTGTCAAGGACAG GGAGTCATTCCCAATGATCCTCGTGGCCAACAAGGTGGATCTGATGCACCTAAGGAAAGTCACCAGGGA

CCAAGGAAAAGAAATGGCAACCAAATACAAT - UNI17585 - ATCCCATATATAGAGACCAGTGCCAAGGACCCGCCTCTCAACGTGGATAAAACCT

TCCATGACCTAGTTAGAGTAATTAG GCAACAGGTTCCAGAGAAAAACCAGAAGAAGAAAAAGAAGACAAAATGGCGAGGAGACAGGGCCACCGGCACTC

ACAAACTGCAGTGTGTCATCTTGTGACAGCCTGAAGCCCTGGGCATAGCAACCGTGAACTGCCAGCCCCTGGGACCAGCCCACTGCCTAACTGCACTGAG

AACCACTTCTAACTACAGCCCTTGGCTCTGGACTGGGCATTGGAAGGGAATGAGGGAGGAGGGGGCAGAAGCAGGCCGGGGCTGGCTTTGCTGCCTCTCC

CAGGAGACAGGGCTACAGCTTCCAAACCTTTTGTGTGTTGACTGAGCCCAGTTCCCAGTCTCTTGGTGGGCTTGTTTCTTTTAACTCCATAGGGCTGGTT

TGCTATGGAAGTGCTTACCCACATACAACGCACCAGACAAGCCATGAGCAAGCTTCCTCCCTGTCCCATCCCCAGTGTCTGAGCTCTTGTGTCTTTTGTA

GATTTTTAAATTATTTGAGTAATGATTATTTTATTAAAGAGGTCTGTGCCCATTG
Translation
 - UNI5955 - - UNI12825 - - UNI33103 - MATSAVPSENLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWA

ILDV - UNI5955 - - UNI15940 - VLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDR RESFPMILVANKVDLMH

LRKVTRDQGKEMATKYN - UNI17585 - IPYIETSAKDPPLNVDKTFHDLVRVIR RQQVPEKNQKKKKKTKWRGDRATGTHKLQCVIL
Transcript ENSMUST00000119472
Sequence
AGATCCAAGCCAGGCCAGCAGTAAAGAGTCATCTGTCCCAGGCCACCACAGCCCTAGGATCATAGACAAGATGAAAAGAGCCAAGGAGGCAGCCATTGAC

CAGGGCAGAACCATCCTGAG - UNI5955 - - UNI12825 - - UNI33103 - GCCTGACTACCAGAAACATGGCGACCAGCGCTGTTCCAAGT

GAAAACCTTCCCACATATAAACTAGTAGTGGTGGGAGATGGTGGTGTGGGCAAGAGTGCGCTCACTATTCAGTTTTTCCAGAAGATCTTTGTGCCTGACT

ACGACCCCACCATTGAAGACTCCTACCTGAAGCATACAGAGATTGACAATCAGTGGGCCATCTTGGATG - UNI5955 - - UNI15940 - TTCTG

GACACAGCCGGGCAGGAGGAGTTCAGTGCCATGCGGGAACAATACATGCGCACAGGGGATGGCTTCCTCATTGTCTACTCCGTCACCGACAAGGCCAGCT

TCGAGCACGTGGACCGCTTCCACCAGCTCATTCTGCGTGTCAAGGACAG GGAGTCATTCCCAATGATCCTCGTGGCCAACAAGGTGGATCTGATGCACC

TAAGGAAAGTCACCAGGGACCAAGGAAAAGAAATGGCAACCAAATACAAT - UNI17585 - ATCCCATATATAGAGACCAGTGCCAAGGACCCGCCT

CTCAACGTGGATAAAACCTTCCATGACCTAGTTAGAGTAATTAG GCAACAGGTTCCAGAGAAAAACCAGAAGAAGAAAAAGAAGACAAAATGGCGAGGA

GACAGGGCCACCGGCACTCACAAACTGCAGTGTGTCATCTTGTGACAGCCTGAAGCCCTGGGCATAGCAACCGTGAACTGCCAGCCCCTGGGACCAGCCC

ACTGCCTAACTGCACTGAGAACCACTTCTAACTACAGCCCTTGGCTCTGGACTGGGCATTGGAAGGGAATGAGGGAGGAGGGGGCAGAAGCAGGCCGGGG

CTGGCTTTGCTGCCTCTCCCAGGAGACAGGGCTACAGCTTCCAAACCTTTTGTGTGTTGACTGAGCCCAGTTCCCAGTCTCTTGGTGGGCTTGTTTCTTT

TAACTCCATAGGGCTGGTTTGCTATGGAAGTGCTTACCCACATACAACGCACCAGACAAGCCATGAGCAAGCTTCCTCCCTGTCCCATCCCCAGTGTCTG

AGCTCTTGTGTCTTTTGTAGATTTTTAAATTATTTGAGTAATGATTATTTTATTAAAGAGGTCTGTGCCCA
Translation
 - UNI5955 - - UNI12825 - - UNI33103 - MATSAVPSENLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWA

ILDV - UNI5955 - - UNI15940 - VLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDR RESFPMILVANKVDLMH

LRKVTRDQGKEMATKYN - UNI17585 - IPYIETSAKDPPLNVDKTFHDLVRVIR RQQVPEKNQKKKKKTKWRGDRATGTHKLQCVIL
Transcript ENSMUST00000035045
Sequence
TTTGTTCCGTTCCGGGGCTGGAGGTGTGGCCGGTTCCGCGTTCGCCGGGCTGCGCTGCGCTGCACCCGGCTGCACCCGGGCAGCGGGCTCCGGCTGTGCG

TGGCCTCTGCCCCCTACCACCGGCTCTGGCTTAACGGTGTGCAGCGGAGAAGTCGCTCACCACTCCGACCCAAGTGGGAAGGGCCTAGCCGCCGCTTAGA

CAGACTCCTTTGATTGTAGTCATCCTGGGGTTCCTCGGCTGCCCGG - UNI5955 - - UNI12825 - - UNI33103 - GCCTGACTACCAGAA

ACATGGCGACCAGCGCTGTTCCAAGTGAAAACCTTCCCACATATAAACTAGTAGTGGTGGGAGATGGTGGTGTGGGCAAGAGTGCGCTCACTATTCAGTT

TTTCCAGAAGATCTTTGTGCCTGACTACGACCCCACCATTGAAGACTCCTACCTGAAGCATACAGAGATTGACAATCAGTGGGCCATCTTGGATG - UN

I5955 - - UNI15940 - TTCTGGACACAGCCGGGCAGGAGGAGTTCAGTGCCATGCGGGAACAATACATGCGCACAGGGGATGGCTTCCTCATTGT

CTACTCCGTCACCGACAAGGCCAGCTTCGAGCACGTGGACCGCTTCCACCAGCTCATTCTGCGTGTCAAGGACAG GGAGTCATTCCCAATGATCCTCGT

GGCCAACAAGGTGGATCTGATGCACCTAAGGAAAGTCACCAGGGACCAAGGAAAAGAAATGGCAACCAAATACAAT - UNI17585 - ATCCCATATA

TAGAGACCAGTGCCAAGGACCCGCCTCTCAACGTGGATAAAACCTTCCATGACCTAGTTAGAGTAATTAG GCAACAGGTTCCAGAGAAAAACCAGAAGA

AGAAAAAGAAGACAAAATGGCGAGGAGACAGGGCCACCGGCACTCACAAACTGCAGTGTGTCATCTTGTGACAGCCTGAAGCCCTGGGCATAGCAACCGT

GAACTGCCAGCCCCTGGGACCAGCCCACTGCCTAACTGCACTGAGAACCACTTCTAACTACAGCCCTTGGCTCTGGACTGGGCATTGGAAGGGAATGAGG

GAGGAGGGGGCAGAAGCAGGCCGGGGCTGGCTTTGCTGCCTCTCCCAGGAGACAGGGCTACAGCTTCCAAACCTTTTGTGTGTTGACTGAGCCCAGTTCC

CAGTCTCTTGGTGGGCTTGTTTCTTTTAACTCCATAGGGCTGGTTTGCTATGGAAGTGCTTACCCACATACAACGCACCAGACAAGCCATGAGCAAGCTT

CCTCCCTGTCCCATCCCCAGTGTCTGAGCTCTTGTGTCTTTTGTAGATTTTTAAATTATTTGAGTAATGATTATTTTATTAAAGAGGTCTGTGCCCATTG

CCTGGCGAAGCCCCAAGTCTTTGGCAGACCTCTGATAAATGTCTGCAATAGGGCTGTTGTCTTCTTAACCGAGTGTTCCTAGCAGTGCCAAACTCCATCC

TGGATGAGAGGCAGAAGTAGGTGGAGTCTTATCAGAAGCCTGGGGTCAAACCCAGGAAGCAAACAGACCCCAGAGACTGGAGAGAGGGGGTGGATTTACC

TGGAGGGCTTTGGTACAGTTGAAAACAAACAAACAAACAACGGCAGAGATTAGAAAACAACCCCCCTCACTACTACACCCCACCCTCAATCCCACCCCCA

CTGAAGTGAGAGCTAGCTGGGACCGGTTCACCCCTGAGGGGATTTCCTTTCCTTGAGTGTGTGGTGAGGCCAGTGACTGGCTTTGCAAAAGGACTCATTT

GCTTTCCATGCTGTGGGTAAATTCTATGTTCAGATATGGACAGTGTCCCTGTTTGCTCTC
Translation
 - UNI5955 - - UNI12825 - - UNI33103 - MATSAVPSENLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWA

ILDV - UNI5955 - - UNI15940 - VLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDR RESFPMILVANKVDLMH

LRKVTRDQGKEMATKYN - UNI17585 - IPYIETSAKDPPLNVDKTFHDLVRVIR RQQVPEKNQKKKKKTKWRGDRATGTHKLQCVIL

For any suggestions or comments, please send an email to unitrap@crg.es