Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032473 (Cldn18)
Chromosomal location
Chr 9: 99591218 - 99617634 (-)
Description
claudin 18 Gene [Source:MGI Symbol;Acc:MGI:1929209]
Human Ortholog
not available
Omim not available
UniTrap UNI36600
Vector Insertion
Chr 9: 99591217 - 99596596
Public Clones IST14261A10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035048
Sequence
GGCCGTGAACCTTCCCAGCAAGAGGGTGGTGGTTGCTCCTGGAAGCCTGCGCCCAGCAGCTGAAGCCATGGCCACCACCACGTGCCAGGTGGTAGGGCTT

CTCCTGTCCCTCCTGGGTCTGGCCGGCTGCATAGCCGCCACTGGGATGGACATGTGGAGCACTCAAGACCTGTATGACAACCCAGTCACCGCCGTGTTCC

AGTATGAAGGGCTCTGGAGGAGTTGCGTGCAACAGAGCTCGGGGTTCACCGAGTGCCGGCCATACTTCACCATCCTGGGCCTTCCAG CCATGCTGCAAG

CTGTACGAGCCCTGATGATCGTGGGCATTGTTCTGGGGGTCATCGGTATCCTCGTGTCCATCTTCGCCCTGAAGTGCATTCGCATTGGTAGCATGGATGA

CTCTGCCAAGGCCAAGATGACTCTGACTTCTGGGATCTTGTTCATCATCTCCG GCATCTGTGCAATCATTGGTGTGTCTGTGTTTGCCAACATGCTGGT

GACCAACTTCTGGATGTCCACAGCTAACATGTACAGCGGCATGGGCGGCATGGGTGGCATGGTGCAGACCGTTCAGACCAG - UNI36600 - GTACA

CCTTTGGTGCAGCTCTGTTCGTGGGCTGGGTTGCTGGAGGCCTCACCCTGATTGGGGGAGTGATGATGTGCATCGCCTGCCGTGGCCTGACACCAGATGA

CAGCAA - UNI36600 - CTTCAAAGCTGTGTCTTACCATGCCTCTGGCCAAAATGTTGCCTACAGGCCTGGAGGCTTTAAGGCCAGCACTGGCTTTG

GGTCCAACACCAGAAACAAGAAGATCTACGATGGGGGTGCCCGCACAGAAGACGATGAACAGTCTCATCCTACCAAGTATGACTATGTGTAGTGCTCTAA

GACCCGCCAACCTGTGTGCAGGAGGAACCCTTCCCCAAGAAGAGCTCACCCCAAAGCAACGGGAGTCTACCTTGTTCCCTTGTTGATTTCAACTGACATC

TGAAAGTTGGTAAAGCCTGATTTTCATCCATAGGGAGGCTAGACAGTCTTGGCCACATGTGTCTGCCTCTAAATATCCCATCACAAAACAGCTGAGTTAT

CGTTTATGAGTTAGAGGCCATAACACTCACTTTAGCCCAACCCTCTGCTTTTTACCGTAGACTTTCTTTTCATCTGGTGATGGAATGGAATTTGACTCAC

AGACTAATACTTTAATGGTTTAGAGAAACTTTCCTTCCTCGTACTTAATAAGCCTGCTGATGGTCGATTTTCCAGCTTGACCACCAAGGGAAATTTTAAA

AGGAAAAAAAAATACATTAAAAGGCATTATTTCCTACTCAATTGTGCCTTACCCACCCCCAACTTGACTGATAATAATAATGAACACCACTTAAAGAAAG

AATGCCAGAGGAAAGATAGTTGTGTTTCCCCCCAGCCAGTCATCTGAGTCCCCCTATGTGGTGATCTAGAACATTACTCGCCACAGTGATTTTCAAAGAA

GGCAAGCGAGCCTGTTCGCTCTGCTCAGCATCTGCTGATTCCAGCAAGGCCCTTCCAGAGCTTTCCACTAGAAGTCCTCCTTCTCTCGGAAGTCAGAAAT

TCCCCCTAGAAGAGTAAGAAATAGATTCTTTTGGGTAACCTGAGTCCTAGGTATAGTTATAATAAATAGTATATTAGCAAAACGGTTTGGTATCTCAGTG

AATTAGTTTCAGCCTTACATATAGAAAAAGCTGGGGAAAAAAAAGCATCCCTTGACATTGTCTATAGCGTAAGATCCTATATAAATCCAAGCTTCAACAA

AAGCTCACTGAGTCTAATAGTTTTCTTTTGAGGTCTCCACGGCCTTAGTACTCATAGATGCAGCCCCTGTTTAAAAGTAAAAAAATTAAAGTAGCTTAAA

ACGGGTTCTTTTTTTTTTTTTTTTTTTCAAAAAATCCAATAGAGACCTGTGTGTCTGGCATAGCTACAGTTACTGCCAATCGACAGGGCCACTTCTTTGG

TCCTGTAGGCAGTTTTGCAGTTCTGACAGCTGCGCCGGGCATCAATATGCAGACCACACCCTTCTCTGTGCTTGTAGGACGACCCGTTCAAGGAGAAAGC

ATGAACTCCATCTCCATGTGAGCCTGAATGCTCCCAGGAAATGGAGATAGGGTGCTCTCTAAAACCCACCTGAACCTGAAACAGCTGTAGCGCTATGCTG

TAAGAGCCTGGCCATCAAGTTCCTATGGAGAAAAAGGGCAGTCCTTGCATTAATAGTGCATATATAAGTGGCCTCTGGGGGGCAGGGATGAATATTCAGT

GGTGGCTCCGAGTATGTACAGACCGTCTAAGGAGCTGTGTTGACCAAGAGCCAGGTTAATACGCAGAGTTTTTCCCACTGGGACTACAGTGATTTTAGAC

TATACTGAAGAAGGCCCTCTGGAAAATCATTATCTGAAATGGCATAAAGAATGAACAGACCAAACAATTTAAGGGGAGGGGGCAGGTGGAAGGAGGGGGA

AGGAGGTAGAAATAAGCAATCTAGGGCATGAAGATTGTTAAGGTTCTTGGGGTCCAAATGGAAGGTCACCCCTTTGAGGCCATGGACACAATGCACCCCA

CCCCTACCCCCACCTGCCCACCCACCAGAAAGTCCCTGGTCGGACTGGAGGCAGTGAGAATCAGCTGTTTTCAGTTAGTGGGTCTCGGTGTAGCACCTGG

CTGTTTCAAAGCTTCCCCTTGCTTTGCCGTTTTTTCCGCCATTGCTGTCTTGTTTTCTGTGTTATTAACCTCCATGTTTTGTACGTTAAATATTAAAACA

CTGTTAACATCCATTC
Translation
MATTTCQVVGLLLSLLGLAGCIAATGMDMWSTQDLYDNPVTAVFQYEGLWRSCVQQSSGFTECRPYFTILGLPA AMLQAVRALMIVGIVLGVIGILVSI

FALKCIRIGSMDDSAKAKMTLTSGILFIISG GICAIIGVSVFANMLVTNFWMSTANMYSGMGGMGGMVQTVQTR - UNI36600 - RYTFGAALFVG

WVAGGLTLIGGVMMCIACRGLTPDDSN - UNI36600 - NFKAVSYHASGQNVAYRPGGFKASTGFGSNTRNKKIYDGGARTEDDEQSHPTKYDYV
Transcript ENSMUST00000112882
Sequence
ATGTCGGTGACCGCCTGCCAGGGCTTGGGGTTTGTGGTGTCACTGATCGGGTTTGCGGGCATCATTGCAGCCACTTGTATGGACCAGTGGAGCACCCAGG

ATTTATACAACAACCCGGTGACCGCTGTATTCAACTACCAAGGGCTATGGCGTTCATGCGTCCGAGAGAGCTCTGGCTTCACCGAGTGCCGAGGCTACTT

CACCCTGTTGGGGTTGCCAG CCATGCTGCAAGCTGTACGAGCCCTGATGATCGTGGGCATTGTTCTGGGGGTCATCGGTATCCTCGTGTCCATCTTCGC

CCTGAAGTGCATTCGCATTGGTAGCATGGATGACTCTGCCAAGGCCAAGATGACTCTGACTTCTGGGATCTTGTTCATCATCTCCG GCATCTGTGCAAT

CATTGGTGTGTCTGTGTTTGCCAACATGCTGGTGACCAACTTCTGGATGTCCACAGCTAACATGTACAGCGGCATGGGCGGCATGGGTGGCATGGTGCAG

ACCGTTCAGACCAG - UNI36600 - GTACACCTTTGGTGCAGCTCTGTTCGTGGGCTGGGTTGCTGGAGGCCTCACCCTGATTGGGGGAGTGATGAT

GTGCATCGCCTGCCGTGGCCTGACACCAGATGACAGCAA - UNI36600 - CTTCAAAGCTGTGTCTTACCATGCCTCTGGCCAAAATGTTGCCTACA

GGCCTGGAGGCTTTAAGGCCAGCACTGGCTTTGGGTCCAACACCAGAAACAAGAAGATCTACGATGGGGGTGCCCGCACAGAAGACGATGAACAGTCTCA

TCCTACCAAGTATGACTATGTGTAGTGCTCTAAGACCCGCCAACCTGTGTGCAGGAGGAACCCTTCCCCAAGAAGAGCTCACCCCAAAGCAACGGGAGTC

TACCTTGTTCCCTTGTTGATTTCAACTGACATCTGAAAGTTGGTAAAGCCTGATTTTCATCCATAGGGAGGCTAGACAGTCTTGGCCACATGTGTCTGCC

TCTAAATATCCCATCACAAAACAGCTGAGTTATCGTTTATGAGTTAGAGGCCATAACACTCACTTTAGCCCAACCCTCTGCTTTTTACCGTAGACTTTCT

TTTCATCTGGTGATGGAATGGAATTTGACTCACAGACTAATACTTTAATGGTTTAGAGAAACTTTCCTTCCTCGTACTTAATAAGCCTGCTGATGGTCGA

TTTTCCAGCTTGACCACCAAGGGAAATTTTAAAAGGAAAAAAAAATACATTAAAAGGCATTATTTCCTACTCAATTGTGCCTTACCCACCCCCAACTTGA

CTGATAATAATAATGAACACCACTTAAAGAAAGAATGCCAGAGGAAAGATAGTTGTGTTTCCCCCCAGCCAGTCATCTGAGTCCCCCTATGTGGTGATCT

AGAACATTACTCGCCACAGTGATTTTCAAAGAAGGCAAGCGAGCCTGTTCGCTCTGCTCAGCATCTGCTGATTCCAGCAAGGCCCTTCCAGAGCTTTCCA

CTAGAAGTCCTCCTTCTCTCGGAAGTCAGAAATTCCCCCTAGAAGAGTAAGAAATAGATTCTTTTGGGTAACCTGAGTCCTAGGTATAGTTATAATAAAT

AGTATATTAGCAAAACGGTTTGGTATCTCAGTGAATTAGTTTCAGCCTTACATATAGAAAAAGCTGGGGAAAAAAAAGCATCCCTTGACATTGTCTATAG

CGTAAGATCCTATATAAATCCAAGCTTCAACAAAAGCTCACTGAGTCTAATAGTTTTCTTTTGAGGTCTCCACGGCCTTAGTACTCATAGATGCAGCCCC

TGTTTAAAAGTAAAAAAATTAAAGTAGCTTAAAACGGGTTCTTTTTTTTTTTTTTTTTTTCAAAAAATCCAATAGAGACCTGTGTGTCTGGCATAGCTAC

AGTTACTGCCAATCGACAGGGCCACTTCTTTGGTCCTGTAGGCAGTTTTGCAGTTCTGACAGCTGCGCCGGGCATCAATATGCAGACCACACCCTTCTCT

GTGCTTGTAGGACGACCCGTTCAAGGAGAAAGCATGAACTCCATCTCCATGTGAGCCTGAATGCTCCCAGGAAATGGAGATAGGGTGCTCTCTAAAACCC

ACCTGAACCTGAAACAGCTGTAGCGCTATGCTGTAAGAGCCTGGCCATCAAGTTCCTATGGAGAAAAAGGGCAGTCCTTGCATTAATAGTGCATATATAA

GTGGCCTCTGGGGGGCAGGGATGAATATTCAGTGGTGGCTCCGAGTATGTACAGACCGTCTAAGGAGCTGTGTTGACCAAGAGCCAGGTTAATACGCAGA

GTTTTTCCCACTGGGACTACAGTGATTTTAGACTATACTGAAGAAGGCCCTCTGGAAAATCATTATCTGAAATGGCATAAAGAATGAACAGACCAAACAA

TTTAAGGGGAGGGGGCAGGTGGAAGGAGGGGGAAGGAGGTAGAAATAAGCAATCTAGGGCATGAAGATTGTTAAGGTTCTTGGGGTCCAAATGGAAGGTC

ACCCCTTTGAGGCCATGGACACAATGCACCCCACCCCTACCCCCACCTGCCCACCCACCAGAAAGTCCCTGGTCGGACTGGAGGCAGTGAGAATCAGCTG

TTTTCAGTTAGTGGGTCTCGGTGTAGCACCTGGCTGTTTCAAAGCTTCCCCTTGCTTTGCCGTTTTTTCCGCCATTGCTGTCTTGTTTTCTGTGTTATTA

ACCTCCATGTTTTGTACGTTAAATATTAAAACACTGTTAACATCCATTC
Translation
MSVTACQGLGFVVSLIGFAGIIAATCMDQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPA AMLQAVRALMIVGIVLGVIGILVSI

FALKCIRIGSMDDSAKAKMTLTSGILFIISG GICAIIGVSVFANMLVTNFWMSTANMYSGMGGMGGMVQTVQTR - UNI36600 - RYTFGAALFVG

WVAGGLTLIGGVMMCIACRGLTPDDSN - UNI36600 - NFKAVSYHASGQNVAYRPGGFKASTGFGSNTRNKKIYDGGARTEDDEQSHPTKYDYV

For any suggestions or comments, please send an email to unitrap@crg.es