Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032475 (Nck1)
Chromosomal location
Chr 9: 100392712 - 100446472 (-)
Description
non-catalytic region of tyrosine kinase adaptor protein 1 Gene [Source:MGI (curated);Acc:Nck1-001]
RefSeq_dna
NM_010878 
RefSeq_peptide
NP_035008.2 
UniGene
Mm.402588 Mm.181485 Mm.367797 
MGI
MGI:109601 
Uniprot/SPTREMBL
Q8BH99 Q8BMV0 Q8BZ27 O55032 Q99M51 Q9Z279 
Human Ortholog
ENSG00000158092 (NCK1)
Omim not available
UniTrap UNI12754
Vector Insertion
Chr 9: 100409092 - 100446413
Public Clones M094E04 (ggtc) IST14260B9 (tigm) IST10034D11 (tigm) IST14509G9 (tigm)
IST14202A7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19122
Vector Insertion
Chr 9: 100408847 - 100409074
Public Clones not available
Private Clones OST404081 (lexicon) OST232415 (lexicon) OST148679 (lexicon) OST60563 (lexicon)
OST42447 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6055
Vector Insertion
Chr 9: 100407276 - 100408847
Public Clones YHD096 (baygenomics) CSG067 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36397
Vector Insertion
Chr 9: 100397676 - 100407276
Public Clones IST10725F6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112874
Sequence
GTTTCAGTGTTACAGAGCAGACCAGGAAGCTCACTGAAAATTATCCCGGAGCTGTGTCAACAAACTGTGAAAAGAGAACACAGAATTTTTATTCAAAATG

GATTGGTTAAACATCTTTAAAGATTTTTTCA - UNI36397 - GTATTGGAAAAGTGAAAAGAAAACCCAGTGTTCCAGATACTGCATCTCCTGCTGA

TGATAGCTTTGTTGATCCAGGAGAACGTCTCTATGACCTTAACATGCCTGCTTTTGTGAAATTTAACTACATGGCTGAGAGAGAGGATGAGTTGTCATTG

ATAAAAGGGACCAAGGTGATCGTCATGGAGAAATGCAGTGATGGATGGTGGCGTGGCAGCTACAACGGACAAATTGGATGGTTTCCTTCAAACTATGTAA

CTGAAGAAGGTGACAGTCCTTTGGGTGATCATGTAGGTTCTCTGTCAGAGAAATTAGCAGCAGTTGTCAATAACCTAAATACGGGTCAAGTATTGCATGT

TGTACAGGCTCTTTACCCGTTTAGCTCATCCAATGATGAAGAACTCAATTTTGAGAAAGGCGATGTAATGGATGTTATTGAAAAGCCGGAAAATGACCCA

GAGTGGTGGAAATGCAGGAAAATCAATGGCATGGTTGGCCTGGTGCCAAAAAACTACGTTACCATTATGCAAAACAATCCATTAACCTCAGGTTTGGAAC

CATCTCCTCCACAATGTGATTACATTAGGCCTTCACTCACTGGGAAGTTTGCTGGCAATCCTTGGTATTATGGCAAAGTCACCAGGCACCAGGCAGAAAT

GGCATTAAATGAAAGAGGGCATGAAGGAGACTTCCTCATTCGTGACAGTGAATCTTCG - UNI36397 - CCAAATGATTTCTCAGTATCACTAAAAG

CACAAGGGAAAAACAAGCATTTTAAAGTCCAGCTGAAAGAGACTGTTTACTGCATTGGGCAGCGGAAATTCAGCACCATGGAGGAACTTGTAGAACATTA

CAAAAAGGCACCGATCTTTACAAGTGAGCAAGGAGAAAAATTATATCTCGTCAAGCATTTGTCTTGATAGTGCTCGTCAGCAGTGACTGTTCCACAGCTT

TAACTGGTCATGTAACTGGAGACTGAGAAAGTGCTGGGCCAATTGTACTTGCTTGGAAAGTGCTGTTTCTAACTATATGAGAATTGACTATAATACATGA

GTATTTTTGTTATAACTCAGCCCATACGTATATACTACATATGCAGTGCATCTCTATAGAAGAGTTCTTTATTCTTGGTCTTACTGTTTTCTTTGCTGTT

TTTCTCTTTCCTTCCAACAATGAAGGTTTTGTATTCTGAAACGAATAATTTGGTTCAAAATCTTTATATGGAAGAATTCTTTTATTGCTGTTTCTTTATT

TCCTTGTAAAGATATCCTGTTCTCCCATAGTTCCTCTTCACATAAAATTATATCTATATGGCATATGATAAAGGACATTCTTGTAAAGTGTTAATCTTTT

CTGTGACTAAATAGCAATAATAAACAGAAAATAAGAAAT
Translation
MDWLNIFKDFFS - UNI36397 - SIGKVKRKPSVPDTASPADDSFVDPGERLYDLNMPAFVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYN

GQIGWFPSNYVTEEGDSPLGDHVGSLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVGLVPKNYVTI

MQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERGHEGDFLIRDSESS - UNI36397 - PNDFSVSLKAQGKNKHFKVQLK

ETVYCIGQRKFSTMEELVEHYKKAPIFTSEQGEKLYLVKHLS
Transcript ENSMUST00000116522
Sequence
GCGGTGGCGTCCCGGTGCGGTCCTCAGGTGACTGGAGCCGAGGGCTCGGCGGAGGGAAG - UNI12754 - TGTTGACGCTGCTGAAAGATGGCTGAA

GAAGTGGTGGTGGTGGCCAAATTTGATTATGTGGCACAGCAGGAACAAGAGCTGGATATCAAGAAGAATGAGCGATTATGGCTCCTGGATGACTCTAAAT

CCTGGTGGCGAGTTCGAAATTCCATGAATAAAACAGGTTTTGTCCCTTCTAACTATGTGGAAAGAAAAAACAGTGCTCGGAAAGCATCTATTGTTAAAAA

CCTGAAGGACACCTTAG - UNI6055 - - UNI19122 - - UNI36397 - GTATTGGAAAAGTGAAAAGAAAACCCAGTGTTCCAGATACTGCA

TCTCCTGCTGATGATAGCTTTGTTGATCCAGGAGAACGTCTCTATGACCTTAACATGCCTGCTTTTGTGAAATTTAACTACATGGCTGAGAGAGAGGATG

AGTTGTCATTGATAAAAGGGACCAAGGTGATCGTCATGGAGAAATGCAGTGATGGATGGTGGCGTGGCAGCTACAACGGACAAATTGGATGGTTTCCTTC

AAACTATGTAACTGAAGAAGGTGACAGTCCTTTGGGTGATCATGTAGGTTCTCTGTCAGAGAAATTAGCAGCAGTTGTCAATAACCTAAATACGGGTCAA

GTATTGCATGTTGTACAGGCTCTTTACCCGTTTAGCTCATCCAATGATGAAGAACTCAATTTTGAGAAAGGCGATGTAATGGATGTTATTGAAAAGCCGG

AAAATGACCCAGAGTGGTGGAAATGCAGGAAAATCAATGGCATGGTTGGCCTGGTGCCAAAAAACTACGTTACCATTATGCAAAACAATCCATTAACCTC

AGGTTTGGAACCATCTCCTCCACAATGTGATTACATTAGGCCTTCACTCACTGGGAAGTTTGCTGGCAATCCTTGGTATTATGGCAAAGTCACCAGGCAC

CAGGCAGAAATGGCATTAAATGAAAGAGGGCATGAAGGAGACTTCCTCATTCGTGACAGTGAATCTTCG - UNI36397 - CCAAATGATTTCTCAGT

ATCACTAAAAGCACAAGGGAAAAACAAGCATTTTAAAGTCCAGCTGAAAGAGACTGTTTACTGCATTGGGCAGCGGAAATTCAGCACCATGGAGGAACTT

GTAGAACATTACAAAAAGGCACCGATCTTTACAAGTGAGCAAGGAGAAAAATTATATCTCGTCAAGCATTTGTCTTGATAGTGCTCGTCAGCAGTGACTG

TTCCACAGCTTTAACTGGTCATGTAACTGGAGACTGAGAAAGTGCTGGGCCAATTGTACTTGCTTGGAAAGTGCTGTTTCTAACTATATGAGAATTGACT

ATAATACATGAGTATTTTTGTTATAACTCAGCCCATACGTATATACTACATATGCAGTGCATCTCTATAGAAGAGTTCTTTATTCTTGGTCTTACTGTTT

TCTTTGCTGTTTTTCTCTTTCCTTCCAACAATGAAGGTTTTGTATTCTGAAACGAATAATTTGGTTCAAAATCTTTATATGGAAGAATTCTTTTATTGCT

GTTTCTTTATTTCCTTGTAAAGATATCCTGTTCTCCCATAGTTCCTCTTCACATAAAATTATATCTATATGGCATATGATAAAGGACATTCTTGTAAAGT

GTTAATCTTTTCTGTGACTAAATAGCAATAATAAACAGAAAATAAGAAATTATTTTCAGATATTGCATCTGTCACAAGCCATTGTAAATATCAAGTATGT

TGTTTGTGCCTTAATTTTTAACAATCCATTCATTGTATCCAAAAGACACCAGATAATAGGTTAGAAAACATAATTTATAGCCATTTTAAACAAAAATACA

AGAATTTAGGGAGTGTCCCCCACACCTCAAGTACCCCCTTTCACGGGATTATTCATGAGAAGAGAGCAGTTTGGGCAGTTGGCTCTTGAAATGAAATGAA

TGTTCCTTAGGTTCTTTGATCAAGTATGGTCTATAGATTGTGCCATATTTATGCCACTGTGAAATAAGCCATAGTCAAGTTTGGGGAATACAGTAGACAA

TGAGATATGTAACTTTTTTTCCTTTCTAAACATCACTAATTCCTCATGTCAGTAATTTAAGGTTTTCAACTTTTCACCATCCTGATCCAGTATCTGATCA

GATTTACTGGAAAACAACAACATTTTTCGACACTATTGAATATTAAACCCAAGGATACACATGAAAAGCAGGTGTTCTGCGCTGAGTGGGTCCCCTAGCC

CCTCGTTACTTATCTTCTAGTTTCTTTAACTGGGAGACACACTGAAGTGATGTGCTATGGTTAGGTAAACAGTATTATCTAAAATTTTCTGTTTGTCATC

TAGTACTTTGTGTGTGTGAATGAGAAACTAAAATACTGAGTCTGCTGTTGGTCACACTTGTCTTCCTTCTGAAATTGTTAATGTAAGTAAAGTAACAGGA

GCCCCTGATGGCACAGAAGCACAAGGACAGATGTTGCTGTTCTCTGCTGGTTTAAACACTCACTGTACCGAATTTACAGCTGGTAAAAATAATAGTTGTG

TAGTTTCACCTTTTCCTTCATTGTAGTAGCTTAAACATTTTAATTTAAATCTTTAACCATTGGAGGCTGATGTTGCCACTGGGTGGCAGCCCTGGCCTCT

CCCACTAAGAAGTCCACAGATATAATTAAAGCACTGATGTATAATTTCAATCTTTATAACACCTGCTTTGAAAGCTTTTTAAGTTACGTTTGTCTTTAAG

TACTCTTTTTTTTGTTGTTGGTTTTTTTGTTTTTTGTATTTTTGTTTAAGGTAAATGGTAGTAGATTGGTTTAATATAAGTAAAGATTATATATATGATA

CCTTTGGAGGTGTAAAATACTGTGACTGGTTTCAGAATGAGTAAGTAGGCAGTAAGCAATCTTAGCGTTTGATGACACTTTATTTTTTGCTTTCTCTTTG

TATGTCCCCCTCCACTGAACAAAATGGACCTTTATAAAAAGAAGCAGATAACTTTATCATGGACATAGCTGTTACTGTGCCTGCAGCACAAGTGATGCTT

TGGGAAGGCAGCGAGCAGTGCCGAGGTGGAATACATACATCCTGCTGTAGCTAGAGCTCGCAGAGAGCGGGGGTGCATCAGTAATGTCTGCACTCTTAAC

TTAGAATGAAACCCAACTATATACTGTTATTTTGTACCTCAAACATTTGATTGATTTTTTTTAAAAATGTTTTCGACTTTTCAACCAAAGTCTGTTCATA

AAGCATGAGTTTTCCTTGGAGCAATTTTCTTAGGAATTAGAACAACCTTGGAAAATGTGTACATAGCTAGGAAGAAAGACTTATAAACATCCAAAACCTA

GTGCTGTGTGTATCTTGACACACTACGTTCTGTGTGCTAGTTTTAGACTAAGAAGTGGGTCCTGGGAAATTGCTATTACAAAAGCTTTCTTCTGAATATG

AAGACATGGTTAGTTCTCAAATTTTGATACACATCGCACCTGTAGTTCTGCCTGGCTTGTGTCTACAAAAACTTCTCTAAAATCTTGGAAGAGGTTTTGT

TCTTAAACAGCTTTACGTATGGGTGCAAGCTTCATGACAAACCAGCCCCCCCCCCCCAAAAAAAAAACCAAAAACAACAACAAAAAAACCCTATAAATGT

TATGTCTCTTATTTGGTCATAAATCTTGGGTGAGTTGTATATTTTCATAATGTGTATTGCATACAATCACTATGTTAACACACACACCTAAGACTATTAA

AGCTGTTTTACAGACATCATTGAGCAAAATACAAAATACCCAGCCCAGAATTATAAGCCTATAATTTTGGCTGCCCATGAGGCTGAGGCAGGAGGACTAT

GAGGCATGCCTGGGTAATTTCTCAAGACACTGTCTGAAAAAAGAGTTGGGATTGCAGTTCTGTAGCAGAGCATGCTAGAAGCCTGGATTCTCTCCCAAGC

ACCACCAAACAAAAAAGGAAGCCAAGCCTATTGCCAGAGTACGGACACCTACCAATGAGCAACTTAGGTTCTTAGAACATTGCATGCAAATCATGTCATT

TTAGTGTTCTGCCATTGCAGTCTAGGGTTGCAAATATATATATGGTCCATGAGGCGACTGTGGGAATTAGGAAAAGGCATTTTCTCCTCATACATCCCAT

GCCTTGTCAAAAAGTGTTGACTTTTACCCACTAATGGTGTAGCCAAATATAGAAGTATTGTTCAACTTATGTAGTATTCAACTTGACAGCACTTAAAACA

GATTTCAGATAACATTGTAATTTATGGTTTAAAAATAAGCTAACAATGTGAGTTGAATTCCCTAGGTAGTAATCAACTTGGAACCTAATGTGGATGGTCT

CATAGTACACATGTGAAAGACATTCAAGCAGAATAATAAAAGTCTTCCCCAACTCTTAACCC
Translation
 - UNI12754 - MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNSARKASIVKNLKDTLG - UNI6055

 - - UNI19122 - - UNI36397 - GIGKVKRKPSVPDTASPADDSFVDPGERLYDLNMPAFVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRG

SYNGQIGWFPSNYVTEEGDSPLGDHVGSLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVGLVPKNY

VTIMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERGHEGDFLIRDSESS - UNI36397 - PNDFSVSLKAQGKNKHFKV

QLKETVYCIGQRKFSTMEELVEHYKKAPIFTSEQGEKLYLVKHLS
Transcript ENSMUST00000035050
Sequence
ATGGCTGAAGAAGTGGTGGTGGTGGCCAAATTTGATTATGTGGCACAGCAGGAACAAGAGCTGGATATCAAGAAGAATGAGCGATTATGGCTCCTGGATG

ACTCTAAATCCTGGTGGCGAGTTCGAAATTCCATGAATAAAACAGGTTTTGTCCCTTCTAACTATGTGGAAAGAAAAAACAGTGCTCGGAAAGCATCTAT

TGTTAAAAACCTGAAGGACACCTTAG - UNI6055 - - UNI19122 - - UNI36397 - GTATTGGAAAAGTGAAAAGAAAACCCAGTGTTCCA

GATACTGCATCTCCTGCTGATGATAGCTTTGTTGATCCAGGAGAACGTCTCTATGACCTTAACATGCCTGCTTTTGTGAAATTTAACTACATGGCTGAGA

GAGAGGATGAGTTGTCATTGATAAAAGGGACCAAGGTGATCGTCATGGAGAAATGCAGTGATGGATGGTGGCGTGGCAGCTACAACGGACAAATTGGATG

GTTTCCTTCAAACTATGTAACTGAAGAAGGTGACAGTCCTTTGGGTGATCATGTAGGTTCTCTGTCAGAGAAATTAGCAGCAGTTGTCAATAACCTAAAT

ACGGGTCAAGTATTGCATGTTGTACAGGCTCTTTACCCGTTTAGCTCATCCAATGATGAAGAACTCAATTTTGAGAAAGGCGATGTAATGGATGTTATTG

AAAAGCCGGAAAATGACCCAGAGTGGTGGAAATGCAGGAAAATCAATGGCATGGTTGGCCTGGTGCCAAAAAACTACGTTACCATTATGCAAAACAATCC

ATTAACCTCAGGTTTGGAACCATCTCCTCCACAATGTGATTACATTAGGCCTTCACTCACTGGGAAGTTTGCTGGCAATCCTTGGTATTATGGCAAAGTC

ACCAGGCACCAGGCAGAAATGGCATTAAATGAAAGAGGGCATGAAGGAGACTTCCTCATTCGTGACAGTGAATCTTCG - UNI36397 - CCAAATGA

TTTCTCAGTATCACTAAAAGCACAAGGGAAAAACAAGCATTTTAAAGTCCAGCTGAAAGAGACTGTTTACTGCATTGGGCAGCGGAAATTCAGCACCATG

GAGGAACTTGTAGAACATTACAAAAAGGCACCGATCTTTACAAGTGAGCAAGGAGAAAAATTATATCTCGTCAAGCATTTGTCTTGATAGTGCTCGTCAG

CAGTGACTGTTCCACAGCTTTAACTGGTCATGTAACTGGAGACTGAGAAAGTGCTGGGCCAATTGTACTTGCTTGGAAAGTGCTGTTTCTAACTATATGA

GAATTGACTATAATACATGAGTATTTTTGTTATAACTCAGCCCATACGTATATACTACATATGCAGTGCATCTCTATAGAAGAGTTCTTTATTCTTGGTC

TTACTGTTTTCTTTGCTGTTTTTCTCTTTCCTTCCAACAATGAAGGTTTTGTATTCTGAAACGAATAATTTGGTTCAAAATCTTTATATGGAAGAATTCT

TTTATTGCTGTTTCTTTATTTCCTTGTAAAGATATCCTGTTCTCCCATAGTTCCTCTTCACATAAAATTATATCTATATGGCATATGATAAAGGACATTC

TTGTAAAGTGTTAATCTTTTCTGTGACTAAATAGCAATAATAAACAGAAAATAAGAAAT
Translation
MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNSARKASIVKNLKDTLG - UNI6055 - - UNI19122 

- - UNI36397 - GIGKVKRKPSVPDTASPADDSFVDPGERLYDLNMPAFVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQIGWFPSNYV

TEEGDSPLGDHVGSLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVGLVPKNYVTIMQNNPLTSGLE

PSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERGHEGDFLIRDSESS - UNI36397 - PNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKF

STMEELVEHYKKAPIFTSEQGEKLYLVKHLS

For any suggestions or comments, please send an email to unitrap@crg.es