Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032478 (Nme6)
Chromosomal location
Chr 9: 109735308 - 109745475 (+)
Description
non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase) Gene [Source:MGI (curated);Acc:Nme6-001]
RefSeq_dna
NM_018757 
RefSeq_peptide
NP_061227.1 
MGI
MGI:1861676 
Uniprot/SWISSPROT
O88425 
Human Ortholog
ENSG00000172113 (NME6)
Omim not available
UniTrap UNI25564
Vector Insertion
Chr 9: 109735555 - 109735810
Public Clones not available
Private Clones OST176763 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36809
Vector Insertion
Chr 9: 109735810 - 109737831
Public Clones IST11382C5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36749
Vector Insertion
Chr 9: 109737929 - 109742121
Public Clones IST11677F5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37187
Vector Insertion
Chr 9: 109742225 - 109743989
Public Clones CMHD-GT_512B2-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035053
Sequence
GGCGGGAGTACCAG - UNI25564 - ATCGCCGGTCCTCCCAGGAGACCCCTTAGCAGCCTGGCCTTGGAATGGCTAGATCAGGTTCATGCACTGATT

CATCCAGCTAAGATCTGTGGAAATCCAG - UNI25564 - - UNI36809 - GGCAGAGATGACCTCCATCTTGCGAAGTCCCCAAGCTCTTCAGCT

CACACTAGCCCTGATCAAGCCTGATGCAGTTGCCCACCCACTGATCCTGGAG - UNI36749 - GCTGTTCATCAGCAGATTCTGAGCAACAAGTTCC

TCATTGTACGAACGAGGGAACTGCAGTGGAAGCTGGAGGACTGCCGGAGGTTTTACCGAGAGCATGAAG - UNI37187 - GGCGTTTTTTCTATCAG

CGGCTGGTGGAGTTCATGACAAG TGGGCCAATCCGAGCCTATATCCTTGCCCACAAAGATGCCATCCAACTTTGGAGGACACTGATGGGACCCACCAGA

GTATTTCGAGCACGCTATATAGCCCCAGATTCAATTCGTGGAAGTTTGGGCCTCACTGACACCCGAAATACTACCCATGGCTCAG ACTCCGTGGTTTCC

GCCAGCAGAGAGATTGCAGCCTTCTTCCCTGACTTCAGTGAACAGCGCTGGTATGAGGAGGAGGAACCCCAGCTGCGGTGTGGTCCTGTGCACTACAGTC

CAGAGGAAGGTATCCACTGTGCAGCTGAAACAGGAGGCCACAAACAACCTAACAAAACCTAGGAGACCCAGCCAAGTAAAGTCCCGAGGACTGGTCGCAG

TGTTCAGCCCTTCCTCCTAGGGTCAGGGAAGGTGGTCTGAAGGCACTGTCCCTGTTGGACCCCTCCATGAGCTGGCAGGTCTAGCCGACCACAGCTCAGC

TGCTGCAGTCCAGTTCTATCTACCTCTCCTGTGGAGTACTCATGGGTGTTCAGGAAGGATGGTGACGCCTCTTTTTACAAAGGACTATCCTCCTTCCTCA

AGAAAGAGCCTGCCTGTTGACTAGTCAGGAAAATGCAGTGCCTGGGTAACCAGCATCCGACCTGGCTTCCTTAATAAATTCTGCTTCCGAATGCTC
Translation
 - UNI25564 -  - UNI25564 - - UNI36809 - MTSILRSPQALQLTLALIKPDAVAHPLILE - UNI36749 - AVHQQILSNKFLIVR

TRELQWKLEDCRRFYREHEG - UNI37187 - GRFFYQRLVEFMTS SGPIRAYILAHKDAIQLWRTLMGPTRVFRARYIAPDSIRGSLGLTDTRNTT

HGSD DSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVHYSPEEGIHCAAETGGHKQPNKT
Transcript ENSMUST00000122343
Sequence
GTAGTGGCTTCCTCAGTTGGCCAGGCAACTTGTAAAACGTGTAAATGTCTGATCGGTTGACAAAGTCAAGCCAGTTTCTTTGCTTGGCAGCACTTTCTTG

TAAACCAATAACTAAGACAGCCCTAACCTAACTGGAACCACACCCTCTCTACAGATCGCCGGTCCTCCCAGGAGACCCCTTAGCAGCCTGGCCTTGGAAT

GGCTAGATCAGGTTCATGCACTGATTCATCCAGCTAAGATCTGTGGAAATCCAG - UNI25564 - - UNI36809 - GGCAGAGATGACCTCCATC

TTGCGAAGTCCCCAAGCTCTTCAGCTCACACTAGCCCTGATCAAGCCTGATGCAGTTGCCCACCCACTGATCCTGGAG - UNI36749 - GCTGTTCA

TCAGCAGATTCTGAGCAACAAGTTCCTCATTGTACGAACGAGGGAACTGCAGTGGAAGCTGGAGGACTGCCGGAGGTTTTACCGAGAGCATGAAG - UN

I37187 - GGCGTTTTTTCTATCAGCGGCTGGTGGAGTTCATGACAAG TGGGCCAATCCGAGCCTATATCCTTGCCCACAAAGATGCCATCCAACTTT

GGAGGACACTGATGGGACCCACCAGAGTATTTCGAGCACGCTATATAGCCCCAGATTCAATTCGTGGAAGTTTGGGCCTCACTGACACCCGAAATACTAC

CCATGGCTCAG ACTCCGTGGTTTCCGCCAGCAGAGAGATTGCAGCCTTCTTCCCTGACTTCAGTGAACAGCGCTGGTATGAGGAGGAGGAACCCCAGCT

GCGGTGTGGTCCTGTGCACTACAGTCCAGAGGAAGGTATCCACTGTGCAGCTGAAACAGGAGGCCACAAACAACCTAACAAAACCTAGGAGACCCAGCCA

AGTAAAGTCCCGAGGACTGGTC
Translation
 - UNI25564 - - UNI36809 - MTSILRSPQALQLTLALIKPDAVAHPLILE - UNI36749 - AVHQQILSNKFLIVRTRELQWKLEDCRRF

YREHEG - UNI37187 - GRFFYQRLVEFMTS SGPIRAYILAHKDAIQLWRTLMGPTRVFRARYIAPDSIRGSLGLTDTRNTTHGSD DSVVSASRE

IAAFFP
Transcript ENSMUST00000119376
Sequence
GTGGGCGCTAAAGTAGTGGCTTCCTCAGTTGGCCAGGCAACTTGTAAAACGTGTAAATGTCTGATCGGTTGACAAAGTCAAGCCAGTTTCTTTGCTTGGC

AGCACTTTCTTGTAAACCAATAACTAAGACAGCCCTAACCTAACTGGAACCACACCCTCTCTACAGATCGCCGGTCCTCCCAGGAGACCCCTTAGCAGCC

TGGCCTTGGAATGGCTAGATCAGGTTCATGCACTGATTCATCCAGCTAAGATCTGTGGAAATCCAG - UNI25564 - - UNI36809 - GGCAGAG

ATGACCTCCATCTTGCGAAGTCCCCAAGCTCTTCAGCTCACACTAGCCCTGATCAAGCCTGATGCAGTTGCCCACCCACTGATCCTGGAG - UNI3674

9 - GCTGTTCATCAGCAGATTCTGAGCAACAAGTTCCTCATTGTACGAACGAGGGAACTGCAGTGGAAGCTGGAGGACTGCCGGAGGTTTTACCGAGAG

CATGAAG - UNI37187 - GGCGTTTTTTCTATCAGCGGCTGGTGGAGTTCATGACAAG ATGCCATCCAACTTTGGAGGACACTGATGGGACCCACC

AGAGTATTTCGAGCACGCTATATAGCCCCAGATTCAATTCGTGGAAGTTTGGGCCTCACTGACACCCGAAATACTACCCATGGCTCAG ACTCCGTGGTT

TCCGCCAGCAGAGAGATTGCAGCCTTCTTCCCTGACTTCAGTGAACAGCGCTGGTATGAGGAGGAGGAACCCCAGCTGCGGTGTGGTCCTGTGCACTACA

GTCCAGAGGAAGGTATCCACTGTGCAGCTGAAACAGGAGGCCACAAACAACCTAACAAAACCTAGGAGACCCAGCCAAGTAAAGTCCCGAGGACTGGTCG

CAGTGTTCAGCCCTTCCTCCTAGGGTCAGGGAAGGTGGTCTGAAGGCACTGTCCCTGTTGGA
Translation
 - UNI25564 - - UNI36809 - MTSILRSPQALQLTLALIKPDAVAHPLILE - UNI36749 - AVHQQILSNKFLIVRTRELQWKLEDCRRF

YREHEG - UNI37187 - GRFFYQRLVEFMTR RCHPTLEDTDGTHQSISSTLYSPRFNSWKFGPH 

For any suggestions or comments, please send an email to unitrap@crg.es