Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032479 (Mtap4)
Chromosomal location
Chr 9: 109833962 - 109986450 (+)
Description
microtubule-associated protein 4 Gene [Source:MGI Symbol;Acc:MGI:97178]
RefSeq_peptide
NP_032659.2 
UniGene
Mm.217318 Mm.397306 Mm.476596 
MGI
MGI:97178 
Uniprot/SWISSPROT
P27546 
Uniprot/SPTREMBL
Q78TF3 
Human Ortholog
ENSG00000047849 (MAP4)
Omim not available
UniTrap UNI9754
Vector Insertion
Chr 9: 109834445 - 109881353
Public Clones (sanger) NPX109 (baygenomics) XG373 (baygenomics) NPX246 (baygenomics)
NPX331 (baygenomics) A033E02 (ggtc) 3SD040H04 (ggtc) 5SH006H06 (ggtc)
3SP142H05 (ggtc) 5SD033G10 (ggtc) 5SD047H09 (ggtc) 3SP133G12 (ggtc)
5SD038H08 (ggtc) 5SH006G06 (ggtc) 5SP137F12 (ggtc) 3SD033G10 (ggtc)
3SD047H09 (ggtc) 3SP126A07 (ggtc) 5SP142H05 (ggtc) 3SD038H08 (ggtc)
3SP137F12 (ggtc) 3SP135D12 (ggtc) IST12207H1 (tigm) IST11271A1 (tigm)
IST14959G6 (tigm) IST12155F2 (tigm) IST11684F11 (tigm) IST14133C6 (tigm)
IST12736H5 (tigm) IST12945B5 (tigm) IST14225B12 (tigm) IST14595F4 (tigm)
IST14559A2 (tigm) IST14459A5 (tigm) IST14286A7 (tigm) IST11935D5 (tigm)
IST14650E1 (tigm) IST12161D4 (tigm)
Private Clones OST433119 (lexicon) OST426632 (lexicon) OST339493 (lexicon) OST335887 (lexicon)
OST318517 (lexicon) OST297589 (lexicon) OST290213 (lexicon) OST279810 (lexicon)
OST259748 (lexicon) OST215132 (lexicon) OST205211 (lexicon) OST200532 (lexicon)
OST191010 (lexicon) OST185175 (lexicon) OST151816 (lexicon) OST129152 (lexicon)
OST98099 (lexicon) OST91819 (lexicon) OST45281 (lexicon) OST45279 (lexicon)
OST38603 (lexicon) OST37449 (lexicon) OST37268 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6321
Vector Insertion
Chr 9: 109881596 - 109902275
Public Clones HMA113 (baygenomics) XH403 (baygenomics) BGD649 (baygenomics) XG653 (baygenomics)
XH779 (baygenomics) BGD650 (baygenomics) XH540 (baygenomics) BGD602 (baygenomics)
XH374 (baygenomics) BGD637 (baygenomics) XG372 (baygenomics) W007H05 (ggtc)
W048D02 (ggtc) CMHD-GT_310A05-3 (cmhd) IST10454A9 (tigm) IST10032B9 (tigm)
Private Clones OST423760 (lexicon) OST355579 (lexicon) OST350475 (lexicon) OST341669 (lexicon)
OST340107 (lexicon) OST329811 (lexicon) OST222645 (lexicon) OST192707 (lexicon)
OST179865 (lexicon) OST129164 (lexicon) OST128858 (lexicon) OST126631 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5288
Vector Insertion
Chr 9: 109902345 - 109928604
Public Clones RRD072 (baygenomics) YTB020 (baygenomics) YHD088 (baygenomics) W061E06 (ggtc)
Private Clones OST375669 (lexicon) OST301288 (lexicon) OST283965 (lexicon) OST280375 (lexicon)
OST224622 (lexicon) OST208998 (lexicon) OST195866 (lexicon) OST58424 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18516
Vector Insertion
Chr 9: 109928728 - 109930182
Public Clones not available
Private Clones OST421953 (lexicon) OST415342 (lexicon) OST345732 (lexicon) OST323486 (lexicon)
OST237411 (lexicon) OST207499 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12053
Vector Insertion
Chr 9: 109930297 - 109934602
Public Clones A042C08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15124
Vector Insertion
Chr 9: 109934738 - 109936876
Public Clones PST4855-NL (escells) PST12507-NR (escells) PST10371-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12453
Vector Insertion
Chr 9: 109938011 - 109939245
Public Clones A004G08 (ggtc)
Private Clones OST379480 (lexicon)
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5709
Vector Insertion
Chr 9: 109939360 - 109954666
Public Clones (sanger) CSI020 (baygenomics) HMA469 (baygenomics) A060F04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13372
Vector Insertion
Chr 9: 109956027 - 109965520
Public Clones CMHD-GT_364H3-3 (cmhd) CMHD-GT_307A05-3 (cmhd) CMHD-GT_378G5-3 (cmhd)
Private Clones OST369685 (lexicon)
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3409
Vector Insertion
Chr 9: 109975210 - 109980506
Public Clones AD0124 (sanger)
Private Clones OST115703 (lexicon)
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37855
Vector Insertion
Chr 9: 109980589 - 109982284
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035055
Sequence
CGGCGGGGCCCACTCAGGCCCACCCGTACGCAGGCGCGTGCGCCTGACACTAGCATCCTTTCTGCTGGAAAAGGAAGCGGCGGCCCTCTCAGAACGGCGG

AGGCGGCCTGAGCCTCGCCATTCGCTGAGGCATCCGCGGGCGGGAGGCCGCAGTCTAGACCCCCGACGCGCGCCGCGCCAACGGTCCGCCACTCGTGCTG

CTTCCACGGAGAGGGCGAGGAGTAGGGGCCGGCGTGGATTGGTTCGCGGCGCCTCGGCCCGCCCTTCGGTGGCGCCCATTGGCTGGGGCGGCACCCGCTG

ACGGCGAGCACGCTCCGCCTTCGTGCCGGCCTTCAAGAGGGCGACGAGGAAGCGGCCACCTCCCTGTGCCCCGCCCCTCCGGCTAGGTCTGTGGCTTCTG

CGGCTCCTCCCGGCTGCTCCCGGCTCCTCTCTGCCCTCTCCCGGCTTCCTGCGGCTCCGGCTTGGGCTCGGCGGCGGCGGCGG - UNI9754 - GCAG

TCGCAGTGGTACAGAATGGCCGACCTCAGTCTTGTGGATGCGTTGACAGAACCACCTCCAGAAATTGAGGGAGAAATAAAGCGAGACTTCATGGCTGCGC

TGGAGGCAGAGCCCTATGATGACATCGTGGGAGAAACTGTGGAGAAAACTGAGTTTATTCCTCTCCTGGATGGTGATGAGAAAACCGGGAACTCAGAGTC

CAAAAAGAAACCCTGCTTAGACACTAGCCAGGTTGAAG - UNI6321 - GTATCCCATCTTCTAAACCAACACTCCTAGCCAATGGTGATCATGGAAT

GGAGGGGAATAACACTGCAG - UNI5288 - GGTCTCCAACTGACTTCCTTGAAGAGAGAGTGGACTATCCGGATTATCAGAGCAGCCAGAACTGGCC

AGAAGATGCAAGCTTTTGTTTCCAGCCTCAGCAAGTGTTAGATACTGACCAGGCTG - UNI18516 - AGCCCTTTAACGAGCACCGTGATGATGGTT

TGGCAGATCTGCTCTTTGTCTCCAGTGGACCCACGAACGCTTCTGCATTTACAGAGCGAGACAATCCTTCAGAAGACAGTTACG - UNI12053 - GT

ATGCTTCCCTGTGACTCATTTGCTTCCACGGCTGTTGTATCTCAGGAGTGGTCTGTGGGAGCCCCAAACTCTCCATGTTCAGAGTCCTGTGTCTCCCCAG

AGGTTACTATAGAAACCCTACAGCCAGCAACAG - UNI15124 - AGCTCTCCAAGGCAGCAGAAGTGGAATCAGTGAAAGAGCAGCTGCCAGCTAAA

GCATTGGAAACGATGGCAGAGCAGACCACTGATGTGGTGCACTCTCCATCCACAGACACAACACCAGGCCCAGACACAGAGGCAGCACTGGCTAAAGACA

TAGAAGAGATCACCAAGCCAGATGTGATATTGGCAAATGTCACGCAGCCATCTACTGAATCGGATATGTTCCTGGCCCAGGACATGGAACTACTCACAGG

AACAGAGGCAGCCCACGCTAACAATATCATATTGCCTACAGAACCAGACGAATCTTCAACCAAGGATGTAGCACCACCTATGGAAGAAGAAATTGTCCCA

GGCAATGATACGACATCCCCCAAAGAAACAGAGACAACACTTCCAATAAAAATGGACTTGGCACCACCTGAGGATGTGTTACTTACCAAAGAAACAGAAC

TAGCCCCAGCCAAGGGCATGGTTTCACTCTCAGAAATAGAAGAGGCTCTGGCAAAGAATGATGAGTCCTCTGCAGAAATACCTGTGGCTCAGGAGACAGT

GGTCTCAGAAACAGAGGTGGTCCTGGCAACAGAAGTGGTACTGCCCTCAGATCCCATAACAACATTGACAAAGGATGTGACACTCCCCTTAGAAGCAGAG

AGACCGTTGGTGACGGACATGACTCCATCTCTGGAAACAGAAATGACCCTAGGCAAAGAGACAGCTCCACCCACAGAAACAAATTTGGGCATGGCCAAAG

ACATGTCTCCACTCCCAGAATCAGAAGTGACTCTGGGCAAGGACGTGGTTATACTTCCAGAAACAAAGGTGGCTGAGTTTAACAATGTGACTCCACTTTC

AGAAGAAGAGGTAACCTCAGTCAAGGACATGTCTCCGTCTGCAGAAACAGAGGCTCCCCTGGCTAAGAATGCTGATCTGCACTCAGGAACAGAGCTGATT

GTGGACAACAGCATGGCTCCAGCCTCCGATCTTGCACTGCCCTTGGAAACAAAAGTAGCAACAGTTCCAATTAAAGACAAAGGAACTGTACAGACTGAAG

AAAAACCACGTGAAGACTCCCAGTTAGCATCTATGCAGCACAAGGGACAGTCAACAGTACCTCCTTGCACGGCTTCACCAG - UNI12453 - AACCA

GTCAAAGCTGCAGAACAAATGTCTACCTTACCAATAGATGCACCTTCTCCATTAGAGAACTTAGAGCAGAAGGAAACGCCTGGCAGCCAGCCTTCTGAGC

CTTGCTCAG - UNI5709 - - UNI13372 - GAGTATCCCGGCAAGAAGAAGCAAAGGCTGCTGTAGGTGTGACTGGAAATGACATCACTACCCCG

CCAAACAAGGAGCCACCACCAAGCCCAGAAAAGAAAGCAAAG CCTTTGGCCACCACTCAACCTGCAAAGACTTCAACATCGAAAGCCAAAACACAGCCC

ACTTCTCTCCCTAAGCAACCAGCTCCCACCACCTCTGGTGGGTTGAATAAAAAACCCATGAGCCTCGCCTCAGGCTCAGTGCCAGCTGCCCCACACAAAC

GCCCTGCTGCTGCCACTGCTACTGCCAGGCCTTCCACCCTACCTGCCAGAGACGTGAAGCCAAAG CCAATTACAGAAGCTAAGGTTGCCGAAAAGCGGA

CCTCTCCATCCAAGCCTTCATCTGCCCCAGCCCTCAAACCTGGACCTAAAACCACCCCAACCGTTTCAAAAGCCACATCTCCCTCAACTCTTGTTTCCAC

TGGACCAAGTAGTAGAAGTCCAGCTACAACTCTGCCTAAGAGGCCAACCA GCATCAAGACTGAGGGGAAACCTGCTGATGTCAAAAGGATGACTGCTAA

GTCTGCCTCAG CTGACTTGAGTCGCTCAAAGACCACCTCTGCCAGTTCTGTGAAGAGAAACACCACTCCCACTGGGGCAGCACCCCCAGCAGGGATGAC

TTCCACTCGAGTCAAGCCCATGTCTGCACCTAGCCGCTCTTCTGGGGCTCTTTCTGTGGACAAGAAGCCCACTTCCACTAAGCCTAGCTCCTCTGCTCCC

AGGGTGAGCCGCCTGGCCACAACTGTTTCTGCCCCTGACCTGAAGAGTGTTCGCTCCAAGGTCGGCTCTACAGAAAACATCAAACACCAGCCTGGAGGAG

GCCGG GCCAAAGTAGAGAAAAAAACAGAGGCAGCTACCACAGCTGGGAAGCCTGAACCTAATGCAGTCACTAAAGCAGCCGGCTCCATTGCGAGTGCAC

AGAAACCGCCTGCTGGGAAA GTCCAGATAGTATCCAAAAAAGTGAGCTACAGCCATATTCAATCCAAGTGTGGTTCCAAGGACAATATTAAGCATGTCC

CTGGAGGTGGCAAT - UNI3409 - GTTCAGATTCAGAACAAGAAAGTGGACATATCCAAGGTCTCCTCCAAGTGTGGGTCCAAAGCTAATATCAAGC

ACAAGCCTG GTGGAGGAGATGTCAAGATTGAAAGTCAGAAGTTGAACTTCAAGGAGAAGGCCCAAGCCAAAGTGGGATCCCTTGATAACGTGGGCCACT

TGCCTGCAGGAGGTGCCGTGAAG ACTGAGGGCGGTGGCAGTGAGGCCCTTCCGTGTCCAGGCCCCCCCGCTGGGGAGGAGCCAGTCATCCCTGAGGCTG

CGCCTGACGCTGGCGCCCCTACTTCAGCCAGTGGCCTCAGTGGCCACACCACCCTGTCAGGGGGTGGTGACCAAAGGGAGCCCCAGACCTTGGACAGCCA

GATCCAGGAGACAA GCATCTAATGATGACATTCTGGTCTCGTCTTCCATCTCCCCTGTGTTCCCTCTCTTGTCTCCCCCCCTTGTTACCCTCTCCCATC

CCTCCTCACGTGTCACTGCAGATTGAGACCTACAGGCTGACGTTCCGGGCAAATGCCAGGGCCCGCACCGACCATGGGGCTGACATTGTCTCCCGGCCTC

CCCACTTCCCTGGTGGCCCAAGCTTGGGGTCTCGAGCCCTGGGCTCCTTTTCCCGGGCTGTCTACTAGACTTGTAAGCTCTTGGGTGCTGGGCAGCCCCT

TTAGGCCTCCCTCCCTCCTGCCTCGCTTGCTCAAGGCAGCAGCAGCCCCACTCGCTGCCATTACACCTCCTTCCACCCCTTTCTGGGCCAACTCCAACTT

CACTATCTCACCACTTCACCACTGCACCACGGAGAAAGTTGGGCGGGGACGGGAGTCCAGTGGGATCTCTGTGGGATCTAGGGGTGAGGAGCTGGATTCC

AGCCTTGGCTGTTTGGTTTTTTTGGACCAAACCCAAAAGAAACTGACAAACCTCTCTTCCCTGGCTCAACCTGGAGGGACTGGTAAAGGTGAACTCCACG

TGGAGACCAGCACCGACTGAATCCCTGGAACCTAAACCACTCCTTGACCCCACGGGGTGGAAGCCACCATTTGGTGGTACCAGGCCCTTTTGCTGCCTCA

CCTCAAGTTAGTCAAGGATCAGTCCTCCTTGTCCCCACGACTTATCGTACCTGAGTAGCTGCTGTCTCACTTTTTTATTCTTTCCTCTCCCAATAACCTA

TGAACTGGTGGTGTAGTTTGCAGGCTGAAGCCATGTCTAAATGAGAGTTCTTGGTAGGTGGTGAGGGAAGTGGGGAAGGAGATCCCGAGTCTCCACTGAG

GAGGCTGTCAGATATTGGCGGGGGTTGCCCTACTCTGGGCAGCTTGGGCCCTGCAGGAAGAAGTGAAGTCAGACAGCTAGGGTGGGTCAGTGTGGCTGAT

TGTGTTGGTATTGTGTGTATGCTGCTTTTCTAACCAAGAGGCTGGTTTTGGCATCTATCTCATTCCCTGGGAATGCGGTGGTTAAATGTGTGATACAAAA

TCAGGGCTGGAGAAACAGAAATGAAGGTCAAAATCGCTGGCCTGTACCTACAGGCCATAGCACCCAAATCCTCATATCTAGGGGAGCCTGAAATGTCCAG

AACGCTTGTGAACAGTGGGGAATCAGGTGTGAAAATTTAAAACTAAAATGCATGAGACTGAGGCCATCCAGTCTTCTGGTGTGGCGGGAGAGGTGGAGCC

ATGGTGGTGCAGCCATCCCAGCGTGGTCTGCTCATGGATGGGATGGTTGCAATGTTGAGAAAATCCCGGGAATTTTATCAACACAAGATTCTTATTGCAC

TTGTATTTTTTGTATTAAAGTTTGCATGGTTTCTAATAAAGGATTCAAACCTAAGTTTGTATTGAAATGGCCTGGGAGTGTCTAAGGGCTCCTCTGATAG

GGCATTTTCTGCTGGGCAGATTTGCCTCTCAGGAGGCTGGCCCAGACTTGGTCCCCTTGGCCCTCCTCCGAACAGACTCTGCCTTTGCTTGGGTACAGTT

TGAGGAGGTAGAGGTCTTTACTCTCTCTCTGCCAAGGGAAGGTATCCCTGGGCTTGAAGGTCTTCTCCATTTATGAGGTAGCAGTTACTTTGTGATAATC

TTGACACTGAATCCCTAGCTCTCTAAGCACACACAAAGAATTGCTGGGACCTGTGGAAAAAAGACTGCCTGAGCTGGGGAGTGGCTTTCTTCCCAAGCTG

TCAGAACTAAGCTTGGAGCCTGCATTGTCTGTATTTTGCAGCAATAGGGGCCCACGGAGCTGGGAAGGACACAGTGGGGACCAGGGTAGTGATGACTGAG

CGTATACAGGTACTTGCTACCCTCCTTGATGTTGATCTTAGGGCCTTGAAGATGCTAAGGAAATTGACAAGAAACAAGTCCATTGGCCAAGGATTAGAGA

AAGGAAGGTAACCCAAGCTCTGTAGGTAGCTCCCTGGAAGGATCCCACGAGCCAGAGAACCTGAGAAGGCTGGTCTAGCAGCTTGGGACCACAGGCCATG

TGATGTGCATACTTCAAAATGTTTGGGAATAAGGTCCTTCTGTATTTTATAGTTTGCTCATGGCTTAGCCATTACCCATGTCTGTAATTGTTGTACTGAT

TTAAACAATAAAGCTGCCTGACATCCC
Translation
 - UNI9754 - MADLSLVDALTEPPPEIEGEIKRDFMAALEAEPYDDIVGETVEKTEFIPLLDGDEKTGNSESKKKPCLDTSQVEG - UNI6321 -

 GIPSSKPTLLANGDHGMEGNNTAG - UNI5288 - GSPTDFLEERVDYPDYQSSQNWPEDASFCFQPQQVLDTDQAE - UNI18516 - EPFNEH

RDDGLADLLFVSSGPTNASAFTERDNPSEDSYG - UNI12053 - GMLPCDSFASTAVVSQEWSVGAPNSPCSESCVSPEVTIETLQPATE - UNI1

5124 - ELSKAAEVESVKEQLPAKALETMAEQTTDVVHSPSTDTTPGPDTEAALAKDIEEITKPDVILANVTQPSTESDMFLAQDMELLTGTEAAHANN

IILPTEPDESSTKDVAPPMEEEIVPGNDTTSPKETETTLPIKMDLAPPEDVLLTKETELAPAKGMVSLSEIEEALAKNDESSAEIPVAQETVVSETEVVL

ATEVVLPSDPITTLTKDVTLPLEAERPLVTDMTPSLETEMTLGKETAPPTETNLGMAKDMSPLPESEVTLGKDVVILPETKVAEFNNVTPLSEEEVTSVK

DMSPSAETEAPLAKNADLHSGTELIVDNSMAPASDLALPLETKVATVPIKDKGTVQTEEKPREDSQLASMQHKGQSTVPPCTASPE - UNI12453 - 

EPVKAAEQMSTLPIDAPSPLENLEQKETPGSQPSEPCSG - UNI5709 - - UNI13372 - GVSRQEEAKAAVGVTGNDITTPPNKEPPPSPEKKA

K PLATTQPAKTSTSKAKTQPTSLPKQPAPTTSGGLNKKPMSLASGSVPAAPHKRPAAATATARPSTLPARDVKPK PITEAKVAEKRTSPSKPSSAPAL

KPGPKTTPTVSKATSPSTLVSTGPSSRSPATTLPKRPTS SIKTEGKPADVKRMTAKSASA ADLSRSKTTSASSVKRNTTPTGAAPPAGMTSTRVKPMS

APSRSSGALSVDKKPTSTKPSSSAPRVSRLATTVSAPDLKSVRSKVGSTENIKHQPGGGR AKVEKKTEAATTAGKPEPNAVTKAAGSIASAQKPPAGK 

VQIVSKKVSYSHIQSKCGSKDNIKHVPGGGN - UNI3409 - VQIQNKKVDISKVSSKCGSKANIKHKPG GGGDVKIESQKLNFKEKAQAKVGSLDN

VGHLPAGGAVK TEGGGSEALPCPGPPAGEEPVIPEAAPDAGAPTSASGLSGHTTLSGGGDQREPQTLDSQIQETS SI
Transcript ENSMUST00000072772
Sequence
CGGCGGGGCCCACTCAGGCCCACCCGTACGCAGGCGCGTGCGCCTGACACTAGCATCCTTTCTGCTGGAAAAGGAAGCGGCGGCCCTCTCAGAACGGCGG

AGGCGGCCTGAGCCTCGCCATTCGCTGAGGCATCCGCGGGCGGGAGGCCGCAGTCTAGACCCCCGACGCGCGCCGCGCCAACGGTCCGCCACTCGTGCTG

CTTCCACGGAGAGGGCGAGGAGTAGGGGCCGGCGTGGATTGGTTCGCGGCGCCTCGGCCCGCCCTTCGGTGGCGCCCATTGGCTGGGGCGGCACCCGCTG

ACGGCGAGCACGCTCCGCCTTCGTGCCGGCCTTCAAGAGGGCGACGAGGAAGCGGCCACCTCCCTGTGCCCCGCCCCTCCGGCTAGGTCTGTGGCTTCTG

CGGCTCCTCCCGGCTGCTCCCGGCTCCTCTCTGCCCTCTCCCGGCTTCCTGCGGCTCCGGCTTGGGCTCGGCGGCGGCGGCGG - UNI9754 - GCAG

TCGCAGTGGTACAGAATGGCCGACCTCAGTCTTGTGGATGCGTTGACAGAACCACCTCCAGAAATTGAGGGAGAAATAAAGCGAGACTTCATGGCTGCGC

TGGAGGCAGAGCCCTATGATGACATCGTGGGAGAAACTGTGGAGAAAACTGAGTTTATTCCTCTCCTGGATGGTGATGAGAAAACCGGGAACTCAGAGTC

CAAAAAGAAACCCTGCTTAGACACTAGCCAGGTTGAAG - UNI6321 - GTATCCCATCTTCTAAACCAACACTCCTAGCCAATGGTGATCATGGAAT

GGAGGGGAATAACACTGCAG - UNI5288 - GGTCTCCAACTGACTTCCTTGAAGAGAGAGTGGACTATCCGGATTATCAGAGCAGCCAGAACTGGCC

AGAAGATGCAAGCTTTTGTTTCCAGCCTCAGCAAGTGTTAGATACTGACCAGGCTG - UNI18516 - AGCCCTTTAACGAGCACCGTGATGATGGTT

TGGCAGATCTGCTCTTTGTCTCCAGTGGACCCACGAACGCTTCTGCATTTACAGAGCGAGACAATCCTTCAGAAGACAGTTACG - UNI12053 - GT

ATGCTTCCCTGTGACTCATTTGCTTCCACGGCTGTTGTATCTCAGGAGTGGTCTGTGGGAGCCCCAAACTCTCCATGTTCAGAGTCCTGTGTCTCCCCAG

AGGTTACTATAGAAACCCTACAGCCAGCAACAG - UNI15124 - AGCTCTCCAAGGCAGCAGAAGTGGAATCAGTGAAAGAGCAGCTGCCAGCTAAA

GCATTGGAAACGATGGCAGAGCAGACCACTGATGTGGTGCACTCTCCATCCACAGACACAACACCAGGCCCAGACACAGAGGCAGCACTGGCTAAAGACA

TAGAAGAGATCACCAAGCCAGATGTGATATTGGCAAATGTCACGCAGCCATCTACTGAATCGGATATGTTCCTGGCCCAGGACATGGAACTACTCACAGG

AACAGAGGCAGCCCACGCTAACAATATCATATTGCCTACAGAACCAGACGAATCTTCAACCAAGGATGTAGCACCACCTATGGAAGAAGAAATTGTCCCA

GGCAATGATACGACATCCCCCAAAGAAACAGAGACAACACTTCCAATAAAAATGGACTTGGCACCACCTGAGGATGTGTTACTTACCAAAGAAACAGAAC

TAGCCCCAGCCAAGGGCATGGTTTCACTCTCAGAAATAGAAGAGGCTCTGGCAAAGAATGATGAGTCCTCTGCAGAAATACCTGTGGCTCAGGAGACAGT

GGTCTCAGAAACAGAGGTGGTCCTGGCAACAGAAGTGGTACTGCCCTCAGATCCCATAACAACATTGACAAAGGATGTGACACTCCCCTTAGAAGCAGAG

AGACCGTTGGTGACGGACATGACTCCATCTCTGGAAACAGAAATGACCCTAGGCAAAGAGACAGCTCCACCCACAGAAACAAATTTGGGCATGGCCAAAG

ACATGTCTCCACTCCCAGAATCAGAAGTGACTCTGGGCAAGGACGTGGTTATACTTCCAGAAACAAAGGTGGCTGAGTTTAACAATGTGACTCCACTTTC

AGAAGAAGAGGTAACCTCAGTCAAGGACATGTCTCCGTCTGCAGAAACAGAGGCTCCCCTGGCTAAGAATGCTGATCTGCACTCAGGAACAGAGCTGATT

GTGGACAACAGCATGGCTCCAGCCTCCGATCTTGCACTGCCCTTGGAAACAAAAGTAGCAACAGTTCCAATTAAAGACAAAGGAACTGTACAGACTGAAG

AAAAACCACGTGAAGACTCCCAGTTAGCATCTATGCAGCACAAGGGACAGTCAACAGTACCTCCTTGCACGGCTTCACCAG - UNI12453 - AACCA

GTCAAAGCTGCAGAACAAATGTCTACCTTACCAATAGATGCACCTTCTCCATTAGAGAACTTAGAGCAGAAGGAAACGCCTGGCAGCCAGCCTTCTGAGC

CTTGCTCAG - UNI5709 - - UNI13372 - GAGTATCCCGGCAAGAAGAAGCAAAGGCTGCTGTAGGTGTGACTGGAAATGACATCACTACCCCG

CCAAACAAGGAGCCACCACCAAGCCCAGAAAAGAAAGCAAAG CCTTTGGCCACCACTCAACCTGCAAAGACTTCAACATCGAAAGCCAAAACACAGCCC

ACTTCTCTCCCTAAGCAACCAGCTCCCACCACCTCTGGTGGGTTGAATAAAAAACCCATGAGCCTCGCCTCAGGCTCAGTGCCAGCTGCCCCACACAAAC

GCCCTGCTGCTGCCACTGCTACTGCCAGGCCTTCCACCCTACCTGCCAGAGACGTGAAGCCAAAG CCAATTACAGAAGCTAAGGTTGCCGAAAAGCGGA

CCTCTCCATCCAAGCCTTCATCTGCCCCAGCCCTCAAACCTGGACCTAAAACCACCCCAACCGTTTCAAAAGCCACATCTCCCTCAACTCTTGTTTCCAC

TGGACCAAGTAGTAGAAGTCCAGCTACAACTCTGCCTAAGAGGCCAACCA GCATCAAGACTGAGGGGAAACCTGCTGATGTCAAAAGGATGACTGCTAA

GTCTGCCTCAG CTGACTTGAGTCGCTCAAAGACCACCTCTGCCAGTTCTGTGAAGAGAAACACCACTCCCACTGGGGCAGCACCCCCAGCAGGGATGAC

TTCCACTCGAGTCAAGCCCATGTCTGCACCTAGCCGCTCTTCTGGGGCTCTTTCTGTGGACAAGAAGCCCACTTCCACTAAGCCTAGCTCCTCTGCTCCC

AGGGTGAGCCGCCTGGCCACAACTGTTTCTGCCCCTGACCTGAAGAGTGTTCGCTCCAAGGTCGGCTCTACAGAAAACATCAAACACCAGCCTGGAGGAG

GCCGG GTCCAGATAGTATCCAAAAAAGTGAGCTACAGCCATATTCAATCCAAGTGTGGTTCCAAGGACAATATTAAGCATGTCCCTGGAGGTGGCAAT 

- UNI3409 - GTTCAGATTCAGAACAAGAAAGTGGACATATCCAAGGTCTCCTCCAAGTGTGGGTCCAAAGCTAATATCAAGCACAAGCCTG GTGGA

GGAGATGTCAAGATTGAAAGTCAGAAGTTGAACTTCAAGGAGAAGGCCCAAGCCAAAGTGGGATCCCTTGATAACGTGGGCCACTTGCCTGCAGGAGGTG

CCGTGAAG ACTGAGGGCGGTGGCAGTGAGGCCCTTCCGTGTCCAGGCCCCCCCGCTGGGGAGGAGCCAGTCATCCCTGAGGCTGCGCCTGACGCTGGCG

CCCCTACTTCAGCCAGTGGCCTCAGTGGCCACACCACCCTGTCAGGGGGTGGTGACCAAAGGGAGCCCCAGACCTTGGACAGCCAGATCCAGGAGACAA 

GCATCTAATGATGACATTCTGGTCTCGTCTTCCATCTCCCCTGTGTTCCCTCTCTTGTCTCCCCCCCTTGTTACCCTCTCCCATCCCTCCTCACGTGTCA

CTGCAGATTGAGACCTACAGGCTGACGTTCCGGGCAAATGCCAGGGCCCGCACCGACCATGGGGCTGACATTGTCTCCCGGCCTCCCCACTTCCCTGGTG

GCCCAAGCTTGGGGTCTCGAGCCCTGGGCTCCTTTTCCCGGGCTGTCTACTAGACTTGTAAGCTCTTGGGTGCTGGGCAGCCCCTTTAGGCCTCCCTCCC

TCCTGCCTCGCTTGCTCAAGGCAGCAGCAGCCCCACTCGCTGCCATTACACCTCCTTCCACCCCTTTCTGGGCCAACTCCAACTTCACTATCTCACCACT

TCACCACTGCACCACGGAGAAAGTTGGGCGGGGACGGGAGTCCAGTGGGATCTCTGTGGGATCTAGGGGTGAGGAGCTGGATTCCAGCCTTGGCTGTTTG

GTTTTTTTGGACCAAACCCAAAAGAAACTGACAAACCTCTCTTCCCTGGCTCAACCTGGAGGGACTGGTAAAGGTGAACTCCACGTGGAGACCAGCACCG

ACTGAATCCCTGGAACCTAAACCACTCCTTGACCCCACGGGGTGGAAGCCACCATTTGGTGGTACCAGGCCCTTTTGCTGCCTCACCTCAAGTTAGTCAA

GGATCAGTCCTCCTTGTCCCCACGACTTATCGTACCTGAGTAGCTGCTGTCTCACTTTTTTATTCTTTCCTCTCCCAATAACCTATGAACTGGTGGTGTA

GTTTGCAGGCTGAAGCCATGTCTAAATGAGAGTTCTTGGTAGGTGGTGAGGGAAGTGGGGAAGGAGATCCCGAGTCTCCACTGAGGAGGCTGTCAGATAT

TGGCGGGGGTTGCCCTACTCTGGGCAGCTTGGGCCCTGCAGGAAGAAGTGAAGTCAGACAGCTAGGGTGGGTCAGTGTGGCTGATTGTGTTGGTATTGTG

TGTATGCTGCTTTTCTAACCAAGAGGCTGGTTTTGGCATCTATCTCATTCCCTGGGAATGCGGTGGTTAAATGTGTGATACAAAATCAGGGCTGGAGAAA

CAGAAATGAAGGTCAAAATCGCTGGCCTGTACCTACAGGCCATAGCACCCAAATCCTCATATCTAGGGGAGCCTGAAATGTCCAGAACGCTTGTGAACAG

TGGGGAATCAGGTGTGAAAATTTAAAACTAAAATGCATGAGACTGAGGCCATCCAGTCTTCTGGTGTGGCGGGAGAGGTGGAGCCATGGTGGTGCAGCCA

TCCCAGCGTGGTCTGCTCATGGATGGGATGGTTGCAATGTTGAGAAAATCCCGGGAATTTTATCAACACAAGATTCTTATTGCACTTGTATTTTTTGTAT

TAAAGTTTGCATGGTTTCTAATAAAGGATTCAAACCTAAGTTTGTATTGAAATGGCCTGGGAGTGTCTAAGGGCTCCTCTGATAGGGCATTTTCTGCTGG

GCAGATTTGCCTCTCAGGAGGCTGGCCCAGACTTGGTCCCCTTGGCCCTCCTCCGAACAGACTCTGCCTTTGCTTGGGTACAGTTTGAGGAGGTAGAGGT

CTTTACTCTCTCTCTGCCAAGGGAAGGTATCCCTGGGCTTGAAGGTCTTCTCCATTTATGAGGTAGCAGTTACTTTGTGATAATCTTGACACTGAATCCC

TAGCTCTCTAAGCACACACAAAGAATTGCTGGGACCTGTGGAAAAAAGACTGCCTGAGCTGGGGAGTGGCTTTCTTCCCAAGCTGTCAGAACTAAGCTTG

GAGCCTGCATTGTCTGTATTTTGCAGCAATAGGGGCCCACGGAGCTGGGAAGGACACAGTGGGGACCAGGGTAGTGATGACTGAGCGTATACAGGTACTT

GCTACCCTCCTTGATGTTGATCTTAGGGCCTTGAAGATGCTAAGGAAATTGACAAGAAACAAGTCCATTGGCCAAGGATTAGAGAAAGGAAGGTAACCCA

AGCTCTGTAGGTAGCTCCCTGGAAGGATCCCACGAGCCAGAGAACCTGAGAAGGCTGGTCTAGCAGCTTGGGACCACAGGCCATGTGATGTGCATACTTC

AAAATGTTTGGGAATAAGGTCCTTCTGTATTTTATAGTTTGCTCATGGCTTAGCCATTACCCATGTCTGTAATTGTTGTACTGATTTAAACAATAAAGCT

GCCTGACATCCC
Translation
 - UNI9754 - MADLSLVDALTEPPPEIEGEIKRDFMAALEAEPYDDIVGETVEKTEFIPLLDGDEKTGNSESKKKPCLDTSQVEG - UNI6321 -

 GIPSSKPTLLANGDHGMEGNNTAG - UNI5288 - GSPTDFLEERVDYPDYQSSQNWPEDASFCFQPQQVLDTDQAE - UNI18516 - EPFNEH

RDDGLADLLFVSSGPTNASAFTERDNPSEDSYG - UNI12053 - GMLPCDSFASTAVVSQEWSVGAPNSPCSESCVSPEVTIETLQPATE - UNI1

5124 - ELSKAAEVESVKEQLPAKALETMAEQTTDVVHSPSTDTTPGPDTEAALAKDIEEITKPDVILANVTQPSTESDMFLAQDMELLTGTEAAHANN

IILPTEPDESSTKDVAPPMEEEIVPGNDTTSPKETETTLPIKMDLAPPEDVLLTKETELAPAKGMVSLSEIEEALAKNDESSAEIPVAQETVVSETEVVL

ATEVVLPSDPITTLTKDVTLPLEAERPLVTDMTPSLETEMTLGKETAPPTETNLGMAKDMSPLPESEVTLGKDVVILPETKVAEFNNVTPLSEEEVTSVK

DMSPSAETEAPLAKNADLHSGTELIVDNSMAPASDLALPLETKVATVPIKDKGTVQTEEKPREDSQLASMQHKGQSTVPPCTASPE - UNI12453 - 

EPVKAAEQMSTLPIDAPSPLENLEQKETPGSQPSEPCSG - UNI5709 - - UNI13372 - GVSRQEEAKAAVGVTGNDITTPPNKEPPPSPEKKA

K PLATTQPAKTSTSKAKTQPTSLPKQPAPTTSGGLNKKPMSLASGSVPAAPHKRPAAATATARPSTLPARDVKPK PITEAKVAEKRTSPSKPSSAPAL

KPGPKTTPTVSKATSPSTLVSTGPSSRSPATTLPKRPTS SIKTEGKPADVKRMTAKSASA ADLSRSKTTSASSVKRNTTPTGAAPPAGMTSTRVKPMS

APSRSSGALSVDKKPTSTKPSSSAPRVSRLATTVSAPDLKSVRSKVGSTENIKHQPGGGR VQIVSKKVSYSHIQSKCGSKDNIKHVPGGGN - UNI34

09 - VQIQNKKVDISKVSSKCGSKANIKHKPG GGGDVKIESQKLNFKEKAQAKVGSLDNVGHLPAGGAVK TEGGGSEALPCPGPPAGEEPVIPEAAP

DAGAPTSASGLSGHTTLSGGGDQREPQTLDSQIQETS SI
Transcript ENSMUST00000065171
Sequence
ATGGACTCCCGGAAAGAAATCGGTCAGGATGGATTTGAATGGCAGAGGACAGAGGGTAAACTGAATGAAATCGGGCTGAATGTCAGCATGGATGGACAGC

TGAAAGACAGGCTTGTGAAGAATTCCAGCTTCCTGGAACAGAATAAGCTCGGCTTTTTTGAGGGGAAGCTAGACAAAGAACTTAGCATCGAAAAGCCTAA

CAAGGCGTATCAAGAAACCTCCGGTCACCTTGAGAGCGGGTATGTGATTTCAGGAACCTGCCAGCCCTCGGAGGGGAACTTAGTTCACCAGAAGGCAGCA

GAGTTCCACCCGGGACTCACCGAGGGGAAAGACAAAGCAGCTACAGTTCAGGGGAAGGTGGCTGGGAAGAGTGGACTAGAGATCAAGAGCCAGCCAGATC

TAAATTTTCCCGGGGCTGCTGACACTCTCACTCAACATGGTGAGGAACAAGAAACCAGTGCTTGGAACGCCAACTTTTACTCAGTAACTCAGAGCCCTCA

GGCTGCAACTCCAGGAAAAGAGAAGAATGGCCTCGTCTCCAGCTGCTCTGTGACTGGGGTGATGAGTGATAACTCTGGGCAGCTTAATAATAAGTCCCCA

TTACTGGTGGCTATCACCCACCCAGACCCAACTAGTGAGCATTTGCCCACCACTAGTCCACCAATCACTATGGTGGAATTCACTCAGGAAAATTTGAATG

CAGGCCAGGATAAAGAGTTGGAGAAATTAAGGTCTTCTGAGGAGGGGCCTATGCTTGACCAAGTACCCCAGCAGAAAAAGGCAATCCGAAGAGCCCTGTC

TGAGTGTTACCATCTCTCAGTGCCCCCAGCTGTGAATCTTGTCGATAAGTACCCTGAGCTGCCTGCCCGAGAGGAGCTTCCTTCTGACCTGCTGCCTCCC

ACCAGTAGCCCAATGCCAAGCCCTATGCCCAGGAAGCTGGGGGTGCCTGCCATGAGGCGCTCCATGACTGTGGCTGAGGACCAGTCAGCTAGCTGCAGAT

TGAGTGCTGGGGAACTGGCCAGCCTGTCTGCTTCTCAGGTACCAACTGCTTTAACCTTCGAGGAACCAGTGGCCAAGGAGAGAGAAGAACAGATCCACTT

CAGCAATGATAGCAACAGCTCTGGGAAGAAGGAACTGGGCATCGCTGGGCTGTATCTCCACAGTAAGCTGGAACAGATTCCCGAAGGAAGCCACAAGGGA

AAGGGGCAGGAAAATACTGGTGAGACAAGAGTTGATTCATGTCCCTTCATCTGCCTGGGAGGCGAGAAACAGCTGATGGCACTGGCAGGGAAGAAAGAAA

TTGAGGTCACTGCAACCCAGAGCATTCCATCATTGCTGTTGGAAGAGACCCCACGTGATG - UNI13372 - GAGTATCCCGGCAAGAAGAAGCAAAG

GCTGCTGTAGGTGTGACTGGAAATGACATCACTACCCCGCCAAACAAGGAGCCACCACCAAGCCCAGAAAAGAAAGCAAAG CCTTTGGCCACCACTCAA

CCTGCAAAGACTTCAACATCGAAAGCCAAAACACAGCCCACTTCTCTCCCTAAGCAACCAGCTCCCACCACCTCTGGTGGGTTGAATAAAAAACCCATGA

GCCTCGCCTCAGGCTCAGTGCCAGCTGCCCCACACAAACGCCCTGCTGCTGCCACTGCTACTGCCAGGCCTTCCACCCTACCTGCCAGAGACGTGAAGCC

AAAG CCAATTACAGAAGCTAAGGTTGCCGAAAAGCGGACCTCTCCATCCAAGCCTTCATCTGCCCCAGCCCTCAAACCTGGACCTAAAACCACCCCAAC

CGTTTCAAAAGCCACATCTCCCTCAACTCTTGTTTCCACTGGACCAAGTAGTAGAAGTCCAGCTACAACTCTGCCTAAGAGGCCAACCA GCATCAAGAC

TGAGGGGAAACCTGCTGATGTCAAAAGGATGACTGCTAAGTCTGCCTCAG CTGACTTGAGTCGCTCAAAGACCACCTCTGCCAGTTCTGTGAAGAGAAA

CACCACTCCCACTGGGGCAGCACCCCCAGCAGGGATGACTTCCACTCGAGTCAAGCCCATGTCTGCACCTAGCCGCTCTTCTGGGGCTCTTTCTGTGGAC

AAGAAGCCCACTTCCACTAAGCCTAGCTCCTCTGCTCCCAGGGTGAGCCGCCTGGCCACAACTGTTTCTGCCCCTGACCTGAAGAGTGTTCGCTCCAAGG

TCGGCTCTACAGAAAACATCAAACACCAGCCTGGAGGAGGCCGG - UNI3409 - GTTCAGATTCAGAACAAGAAAGTGGACATATCCAAGGTCTCCT

CCAAGTGTGGGTCCAAAGCTAATATCAAGCACAAGCCTG GTGGAGGAGATGTCAAGATTGAAAGTCAGAAGTTGAACTTCAAGGAGAAGGCCCAAGCCA

AAGTGGGATCCCTTGATAACGTGGGCCACTTGCCTGCAGGAGGTGCCGTGAAG ACTGAGGGCGGTGGCAGTGAGGCCCTTCCGTGTCCAGGCCCCCCCG

CTGGGGAGGAGCCAGTCATCCCTGAGGCTGCGCCTGACGCTGGCGCCCCTACTTCAGCCAGTGGCCTCAGTGGCCACACCACCCTGTCAGGGGGTGGTGA

CCAAAGGGAGCCCCAGACCTTGGACAGCCAGATCCAGGAGACAA GCATCTAATGATGACATTCTGGTCTCGTCTTCCATCTCCCCTGTGTTCCCTCTCT

TGTCTCCCCCCCTTGTTACCCTCTCCCATCCCTCCTCACGTGTCACTGCAGATTGAGACCTACAGGCTGACGTTCCGGGCAAATGCCAGGGCCCGCACCG

ACCATGGGGCTGACATTGTCTCCCGGCCTCCCCACTTCCCTGGTGGCCCAAGCTTGGGGTCTCGAGCCCTGGGCTCCTTTTCCCGGGCTGTCTACTAGAC

TTGTAAGCTCTTGGGTGCTGGGCAGCCCCTTTAGGCCTCCCTCCCTCCTGCCTCGCTTGCTCAAGGCAGCAGCAGCCCCACTCGCTGCCATTACACCTCC

TTCCACCCCTTTCTGGGCCAACTCCAACTTCACTATCTCACCACTTCACCACTGCACCACGGAGAAAGTTGGGCGGGGACGGGAGTCCAGTGGGATCTCT

GTGGGATCTAGGGGTGAGGAGCTGGATTCCAGCCTTGGCTGTTTGGTTTTTTTGGACCAAACCCAAAAGAAACTGACAAACCTCTCTTCCCTGGCTCAAC

CTGGAGGGACTGGTAAAGGTGAACTCCACGTGGAGACCAGCACCGACTGAATCCCTGGAACCTAAACCACTCCTTGACCCCACGGGGTGGAAGCCACCAT

TTGGTGGTACCAGGCCCTTTTGCTGCCTCACCTCAAGTTAGTCAAGGATCAGTCCTCCTTGTCCCCACGACTTATCGTACCTGAGTAGCTGCTGTCTCAC

TTTTTTATTCTTTCCTCTCCCAATAACCTATGAACTGGTGGTGTAGTTTGCAGGCTGAAGCCATGTCTAAATGAGAGTTCTTGGTAGGTGGTGAGGGAAG

TGGGGAAGGAGATCCCGAGTCTCCACTGAGGAGGCTGTCAGATATTGGCGGGGGTTGCCCTACTCTGGGCAGCTTGGGCCCTGCAGGAAGAAGTGAAGTC

AGACAGCTAGGGTGGGTCAGTGTGGCTGATTGTGTTGGTATTGTGTGTATGCTGCTTTTCTAACCAAGAGGCTGGTTTTGGCATCTATCTCATTCCCTGG

GAATGCGGTGGTTAAATGTGTGATACAAAATCAGGGCTGGAGAAACAGAAATGAAGGTCAAAATCGCTGGCCTGTACCTACAGGCCATAGCACCCAAATC

CTCATATCTAGGGGAGCCTGAAATGTCCAGAACGCTTGTGAACAGTGGGGAATCAGGTGTGAAAATTTAAAACTAAAATGCATGAGACTGAGGCCATCCA

GTCTTCTGGTGTGGCGGGAGAGGTGGAGCCATGGTGGTGCAGCCATCCCAGCGTGGTCTGCTCATGGATGGGATGGTTGCAATGTTGAGAAAATCCCGGG

AATTTTATCAACACAAGATTCTTATTGCACTTGTATTTTTTGTATTAAAGTTTGCATGGTTTCTAATAAAGGATTCAAACCTAAGTTTGTATTGAAATGG

CCTGGGAGTGTCTAAGGGCTCCTCTGATAGGGCATTTTCTGCTGGGCAGATTTGCCTCTCAGGAGGCTGGCCCAGACTTGGTCCCCTTGGCCCTCCTCCG

AACAGACTCTGCCTTTGCTTGGGTACAGTTTGAGGAGGTAGAGGTCTTTACTCTCTCTCTGCCAAGGGAAGGTATCCCTGGGCTTGAAGGTCTTCTCCAT

TTATGAGGTAGCAGTTACTTTGTGATAATCTTGACACTGAATCCCTAGCTCTCTAAGCACACACAAAGAATTGCTGGGACCTGTGGAAAAAAGACTGCCT

GAGCTGGGGAGTGGCTTTCTTCCCAAGCTGTCAGAACTAAGCTTGGAGCCTGCATTGTCTGTATTTTGCAGCAATAGGGGCCCACGGAGCTGGGAAGGAC

ACAGTGGGGACCAGGGTAGTGATGACTGAGCGTATACAGGTACTTGCTACCCTCCTTGATGTTGATCTTAGGGCCTTGAAGATGCTAAGGAAATTGACAA

GAAACAAGTCCATTGGCCAAGGATTAGAGAAAGGAAGGTAACCCAAGCTCTGTAGGTAGCTCCCTGGAAGGATCCCACGAGCCAGAGAACCTGAGAAGGC

TGGTCTAGCAGCTTGGGACCACAGGCCATGTGATGTGCATACTTCAAAATGTTTGGGAATAAGGTCCTTCTGTATTTTATAGTTTGCTCATGGCTTAGCC

ATTACCCATGTCTGTAATTGTTGTACTGATTTAAACAATAAAGCTGCCTGACATCCC
Translation
MDSRKEIGQDGFEWQRTEGKLNEIGLNVSMDGQLKDRLVKNSSFLEQNKLGFFEGKLDKELSIEKPNKAYQETSGHLESGYVISGTCQPSEGNLVHQKAA

EFHPGLTEGKDKAATVQGKVAGKSGLEIKSQPDLNFPGAADTLTQHGEEQETSAWNANFYSVTQSPQAATPGKEKNGLVSSCSVTGVMSDNSGQLNNKSP

LLVAITHPDPTSEHLPTTSPPITMVEFTQENLNAGQDKELEKLRSSEEGPMLDQVPQQKKAIRRALSECYHLSVPPAVNLVDKYPELPAREELPSDLLPP

TSSPMPSPMPRKLGVPAMRRSMTVAEDQSASCRLSAGELASLSASQVPTALTFEEPVAKEREEQIHFSNDSNSSGKKELGIAGLYLHSKLEQIPEGSHKG

KGQENTGETRVDSCPFICLGGEKQLMALAGKKEIEVTATQSIPSLLLEETPRDG - UNI13372 - GVSRQEEAKAAVGVTGNDITTPPNKEPPPSPE

KKAK PLATTQPAKTSTSKAKTQPTSLPKQPAPTTSGGLNKKPMSLASGSVPAAPHKRPAAATATARPSTLPARDVKPK PITEAKVAEKRTSPSKPSSA

PALKPGPKTTPTVSKATSPSTLVSTGPSSRSPATTLPKRPTS SIKTEGKPADVKRMTAKSASA ADLSRSKTTSASSVKRNTTPTGAAPPAGMTSTRVK

PMSAPSRSSGALSVDKKPTSTKPSSSAPRVSRLATTVSAPDLKSVRSKVGSTENIKHQPGGGR - UNI3409 - VQIQNKKVDISKVSSKCGSKANIK

HKPG GGGDVKIESQKLNFKEKAQAKVGSLDNVGHLPAGGAVK TEGGGSEALPCPGPPAGEEPVIPEAAPDAGAPTSASGLSGHTTLSGGGDQREPQTL

DSQIQETS SI

For any suggestions or comments, please send an email to unitrap@crg.es