Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032480 (Dhx30)
Chromosomal location
Chr 9: 109986825 - 110019926 (-)
Description
DEAH (Asp-Glu-Ala-His) box polypeptide 30 Gene [Source:MGI Symbol;Acc:MGI:1920081]
RefSeq_dna
NM_133347 
RefSeq_peptide
NP_579925.1 
UniGene
Mm.469628 
MGI
MGI:1920081 
Uniprot/SWISSPROT
Q99PU8 
Uniprot/SPTREMBL
Q80TP6 
Human Ortholog
ENSG00000132153 (DHX30)
Omim not available
UniTrap UNI10489
Vector Insertion
Chr 9: 110018087 - 110019861
Public Clones (sanger) D103D10 (ggtc) D097C08 (ggtc) E053G09 (ggtc) D102D10 (ggtc)
P068D01 (ggtc) D097F06 (ggtc) PST6179-NR (escells) IST15070B7 (tigm)
IST14241G1 (tigm) IST10460B8 (tigm) IST11629E4 (tigm) IST12639C12 (tigm)
IST11084B4 (tigm) IST10919A1 (tigm) IST14640H10 (tigm) IST12379A2 (tigm)
IST12137D1 (tigm)
Private Clones OST443137 (lexicon) OST433212 (lexicon) OST304486 (lexicon) OST240521 (lexicon)
OST201913 (lexicon) OST195722 (lexicon) OST174698 (lexicon) OST134374 (lexicon)
OST109756 (lexicon) OST83703 (lexicon) OST68302 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33498
Vector Insertion
Chr 9: 110017539 - 110018087
Public Clones IST11664E10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23347
Vector Insertion
Chr 9: 110017539 - 110017666
Public Clones not available
Private Clones OST262811 (lexicon) OST179256 (lexicon) OST107682 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23118
Vector Insertion
Chr 9: 110015595 - 110017539
Public Clones (ggtc) E115D06 (ggtc) IST14444H2 (tigm) IST10130F12 (tigm) IST13599A7 (tigm)
IST14976D10 (tigm)
Private Clones OST275821 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16336
Vector Insertion
Chr 9: 110011626 - 110015474
Public Clones not available
Private Clones OST462958 (lexicon) OST457861 (lexicon) OST337909 (lexicon) OST319340 (lexicon)
OST281456 (lexicon) OST281438 (lexicon) OST264539 (lexicon) OST243699 (lexicon)
OST239259 (lexicon) OST239247 (lexicon) OST162062 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20645
Vector Insertion
Chr 9: 110001364 - 110003319
Public Clones (ggtc) CMHD-GT_468D9-3 (cmhd) CMHD-GT_465F6-3 (cmhd) CMHD-GT_472D7-3 (cmhd)
CMHD-GT_460H2-3 (cmhd) CMHD-GT_465H3-3 (cmhd) CMHD-GT_472A8-3 (cmhd) CMHD-GT_454H10-3 (cmhd)
IST10266H8 (tigm) IST10818B5 (tigm)
Private Clones OST355860 (lexicon) OST355525 (lexicon) OST298674 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28131
Vector Insertion
Chr 9: 109990771 - 109991056
Public Clones not available
Private Clones OST39076 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35907
Vector Insertion
Chr 9: 109988453 - 109988831
Public Clones IST10248H3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19988
Vector Insertion
Chr 9: 109987558 - 109987648
Public Clones not available
Private Clones OST375770 (lexicon)
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24020
Vector Insertion
Chr 9: 109987373 - 109987453
Public Clones not available
Private Clones OST237476 (lexicon)
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035056
Sequence
GTAGTTGGGGGGGCCCGCGGCTCATGCGCCGTGCACCGAGGCTTGTTTCACATCTGTAACAACAG - UNI10489 - - UNI33498 - GAGGCCCA

GCCTCGTGATGAGGAATAGCAAGGAGAGAATTCAGCTCCAGTTTAAAAGCCTGCAAAATCAGAGCCCCTCCCTGCTTTTATAAG - UNI23347 - - 

UNI33498 - ATGAAGACAGGAAAAGACTGTGGTATATGAAACTTTGTTGACAAGAGAGGATCCAGAGACTTTAAAAGCAAAACTCTGCTGGGCATGGT

GACTCCTGTCTGTAATTCCAGCACTTGGCAGCCCAAG - UNI23118 - - UNI23347 - - UNI33498 - GATTCCAGCTTTCTCTCCTGGCC

AGAAATGTTCAGCTTGGACTCATTCAGAAAAG - UNI16336 - ATCGGACCCAGCACAGGCAGCGTCAATGCAAGCTTCCCCCACCCCGTCTTCCAC

CCATGTGTGTCAACCCTGCCCCTGGAGGGACCATCACTCGAG - UNI20645 - CTTCTAGGGACCTATTAAAAGAGTTTCCGCAGCCTAAAAACCTT

CTCAACAGCGTGATTGGAAGAGCCCTTGGCATCTCACATGCAAAAGACAAGTTAGTCTATGTGCACACGAATGGACCGAAGAAAAAG AAAGTCACCCTG

CACATAAAGTGGCCCAAGAGCGTGGAGGTGGAAGGCTATGGCAGCAAGAAGATTGATGCTGAGCGTCAGGCTGCAGCAGCTGCCTGCCAACTCTTCAAG 

GGCTGGGGTCTGCTGGGACCACGGAATGAGCTGTTTGATGCAGCTAAATACCGAGTGCTAGCTGATCGTTTTGGGTCTCCAGCTGACAGCTGGTGGCGCC

CAGAACCCACCATGCCTCCAACTTCCTGGCGGCAGCTGAATCCTGAGAACATTCGGCCAGGGGGTCCTGCAGGACTATCCCGATCCTTAGGCCGAGAGGA

AGAGGAAGATGAGGAGGAAGAGCTAGAAGAGGGGACCATTGATGTGACAGAGTTTCTGTCTATGACCCAGCAAGACTCCCACAACCCACTCAGGGACTCA

AG GGGGGGCTCCTTTGAAATGACAGATGATGACAGTGCTATCAGAGCTCTGACCCAGTTTCCACTTCCCAAGAACCTCCTGGCCAAAGTGATTCAGATT

GCAACCTCCTCCTCCACAGCTAAG AATCTCATGCAGTTCCATACTGTGGGTACCAAGACCAAGCTGGCTACACTCACTCTGCTCTGGCCCTGTCCCATG

ACCTTTGTTGCCAAAGGGCGACGCAAAGCTGAGGCTGAGAATAAGGCAGCAGCCTTGGCTTGCAAGAAACTGAAG AGCCTTGGCCTTGTGGACAGGAAC

AATGAGCCGCTTACCCATGCCATGTACAACCTGGCCTCCCTGCGTGAGTTGGGTGAGACCCAGCGCCGGCCATGTACCATCCAGGTGCCTGAGCCCATCC

TTCGCAAGATAGAGGCCTTCCTGAGTCAT - UNI28131 - TACCCGGTGGACAGCTCATGGATTTCCCCAGAACTCCGACTGCAGAGTGATGACATC

TTGCCCTTAGGCAAGGACTCAGGGCCCTTGAGTGACCCTATCACAGGCAAGCCATACATGCCCCTGTCAGAAGCAGAGGAGGTGCGCTTAAGCCAGAGCC

TGCTAGAGCTGTGGCGGAGGAGAGGGCCGATCTGGCAGGAGGCCCCGCAGCTACCTGTAGACCCTCATCGGGACACTATCCTCAGTGCCATTGAACAACA

CCCAGTGGTAGTCATCTCTGGGGACACAGGCTGTGGGAAGACCACACGTATCCCTCAGCTGCTATTGGAGCGCTATGTGACTGAGGGTCGAGGTGCCCGC

TGCAATGTGATCATCACACAACCTCGCCGGATCTCAGCTGTGTCTGTGGCACAGCGGGTCAGCCATGAACTGGGCCCCTCCTTGCGCCGGAATGTGGGCT

TCCAGGTACGCTTGGAAAGTAAGCCCCCAGCCCGAGGTGGGGCGCTGCTCTTCTGCACTGTGGGTATCCTGCTTCGGAAGCTGCAGAGCAACCCCAGCCT

GGAGGGTGTGAGCCATGTCATTGTGGATGAGGTCCATGAGCGGGATGTGAACACAGACTTCCTGCTGATTCTGCTCAAGGGCCTGCAGCGGCTCAACCCA

GCTCTTCGGCTGGTGCTCATGAGTGCTACAGGAGATAATGAGCGCTTTTCCCGATACTTTGGGGGCTGCCCTGTTATCAAGGTACCTGGCTTCATGTATC

CCGTCAAGGAACACTACCTGGAGGACATCTTGGCCAAGCTGGGTAAACATCAGTACCCACACCGGCATCGGCACCATGAG TCGGAAGATGAATGTGCAC

TTGATTTGGACCTTGTGACTGACCTGGTTCTGCATATCGATGCCCGTGGGGAACCAG GTGGGATCCTGTGCTTTCTACCTGGCTGGCAAGAAATCAAAG

GAGTGCAACAACGGCTCCAGGAGGCCCTGGGCATGCATGAAAGCAAGTACCTCATCTTACCAG TGCACTCCAATATCCCCATGATGGACCAGAAGGCCA

TATTCCAACAGCCTCCACTTGGGGTACGCAAGATTGTATTGGCCACCAACATTGCTGAAACCTCCATCACAGTTAACGACATTGTACATGTCGTGGACAG

CGGTCTGCACAAGGAGGAACGCTATGACCTGAAGACCAAG - UNI35907 - GTGTCCTGCCTGGAGACTGTGTGGGTGTCGAGAGCAAATGTCATTC

AGCGCCGGGGCAGGGCAGGCCGCTGCCAGTCAGGTTTTGCCTACCACTTGTTCCCGAGGAGCCGGCTGGAGAAAATGGTTCCTTTCCAAGTGCCAGAGAT

CCTGCGCACACCTCTTGAGAACCTGGTGCTGCAAGCCAAAATCCATATGCCTGAGAAGACG - UNI35907 - GCAGTGGAGTTCCTCTCTAAGGCTG

TGGACAGTCCAAATATCAAGGCAGTGGATGAGGCCGTGATCCTGCTCCAGGAGATTG - UNI35907 - GGGTGCTGGACCAGCGGGAGTATCTGACC

ACCTTGGGACAGCGCCTGGCCCACATCTCTACTGACCCCCGACTGGCCAAGGCCATAGTGTTGGCTGCCATCTTCCGTTGCCTGCACCCACTGCTGGTGG

TTGTTTCCTGCCTTACCCGGGACCCCTTCAGCAGCAGTTTGCAGAACCGGGCAGAAGTAGACAAG GTGAAGGCATTGCTGAGCCATGACAGTGGCAGTG

ACCATTTGGCCTTCGTGCGGGCTGTGGCTGGCTGGGAGGAGGTACTGCGCTGGCAGGACCGTACCTCCAGGGAAAACTACCTGGAAGAAAACCTTCTGTA

TGCCCCCAGCTTGCGCTTCATCCACG GGCTCATCAAGCAGTTCTCAGAGAACATTTATGAGGCTTTCCTAGTGGGGAAGCCCTCTGACTGCACACTGCC

CTCTGCTCAGTGCAATGAGTACAGCGAGGAAGAGGAGCTGGTGAAGGGTGTGCTGATGGCTGGCCTCTACCCCAACCTCATCCAG - UNI19988 - G

TGAGACAAGGTAAGGTTACTCGGCAAGGCAAGTTCAAACCCAACAGTGTCACTTACAGGACCAAATCTGGCAACATCTTGCTGCATAAGTCAACCATTAA

CAG - UNI24020 - GGAGGCTACCCGGTTACGGAGCCGATGGCTGACATATTTCATGGCCGTCAAGTCCAATGGTAGCGTCTTTGTTCGAGATTCCT

CCCAGGTGCACCCACTAGCTGTGTTGCTCCTAACAGATGGGGACGTGCACATCCGAG ATGATGGGCGTCGGGCCACCATCTCATTGAGTGACAGCGACC

TGCTTCGGCTGGAAGGTGATTCACGAACTGTGCGGTTGCTAAGGGAGTTTCGTCGAGCCCTAGGACGGATGGTGGAGCGGAGCCTCCGCAGCGAGTTAGC

TGCACTTCCTCTTAGTGTGCAGCAAGAACACGGGCAGCTGCTTGCACTGCTGGCAGAGTTGCTTCGAGGACCTTGTGGCAGCTTTGATATGCGCAAGACA

GCTGATGACTGAGCCTCTCTTCCGCTGGGGCTATGTACAGAGTGCAAATGTTTATTTAAAATAAAGTTATATTTATCCCTTGTG
Translation
 - UNI10489 - - UNI33498 -  - UNI23347 - - UNI33498 - MVTPVCNSSTWQPK - UNI23118 - - UNI23347 - - UNI

33498 - DSSFLSWPEMFSLDSFRKD - UNI16336 - DRTQHRQRQCKLPPPRLPPMCVNPAPGGTITRA - UNI20645 - ASRDLLKEFPQP

KNLLNSVIGRALGISHAKDKLVYVHTNGPKKK KVTLHIKWPKSVEVEGYGSKKIDAERQAAAAACQLFK GWGLLGPRNELFDAAKYRVLADRFGSPAD

SWWRPEPTMPPTSWRQLNPENIRPGGPAGLSRSLGREEEEDEEEELEEGTIDVTEFLSMTQQDSHNPLRDSR RGGSFEMTDDDSAIRALTQFPLPKNLL

AKVIQIATSSSTAK NLMQFHTVGTKTKLATLTLLWPCPMTFVAKGRRKAEAENKAAALACKKLK SLGLVDRNNEPLTHAMYNLASLRELGETQRRPCT

IQVPEPILRKIEAFLSH - UNI28131 - YPVDSSWISPELRLQSDDILPLGKDSGPLSDPITGKPYMPLSEAEEVRLSQSLLELWRRRGPIWQEAPQ

LPVDPHRDTILSAIEQHPVVVISGDTGCGKTTRIPQLLLERYVTEGRGARCNVIITQPRRISAVSVAQRVSHELGPSLRRNVGFQVRLESKPPARGGALL

FCTVGILLRKLQSNPSLEGVSHVIVDEVHERDVNTDFLLILLKGLQRLNPALRLVLMSATGDNERFSRYFGGCPVIKVPGFMYPVKEHYLEDILAKLGKH

QYPHRHRHHE SEDECALDLDLVTDLVLHIDARGEPG GGILCFLPGWQEIKGVQQRLQEALGMHESKYLILPV VHSNIPMMDQKAIFQQPPLGVRKIV

LATNIAETSITVNDIVHVVDSGLHKEERYDLKTK - UNI35907 - VSCLETVWVSRANVIQRRGRAGRCQSGFAYHLFPRSRLEKMVPFQVPEILRT

PLENLVLQAKIHMPEKT - UNI35907 - AVEFLSKAVDSPNIKAVDEAVILLQEIG - UNI35907 - GVLDQREYLTTLGQRLAHISTDPRLAK

AIVLAAIFRCLHPLLVVVSCLTRDPFSSSLQNRAEVDK VKALLSHDSGSDHLAFVRAVAGWEEVLRWQDRTSRENYLEENLLYAPSLRFIHG GLIKQF

SENIYEAFLVGKPSDCTLPSAQCNEYSEEEELVKGVLMAGLYPNLIQ - UNI19988 - VRQGKVTRQGKFKPNSVTYRTKSGNILLHKSTINR - U

NI24020 - REATRLRSRWLTYFMAVKSNGSVFVRDSSQVHPLAVLLLTDGDVHIRD DDGRRATISLSDSDLLRLEGDSRTVRLLREFRRALGRMVER

SLRSELAALPLSVQQEHGQLLALLAELLRGPCGSFDMRKTADD
Transcript ENSMUST00000111991
Sequence
GTAGTTGGGGGGGCCCGCGGCTCATGCGCCGTGCACCGAGGCTTGTTTCACATCTGTAACAACAG - UNI10489 - - UNI33498 - GAGGCCCA

GCCTCGTGATGAGGAATAGCAAGGAGAGAATTCAGCTCCAGTTTAAAAGCCTGCAAAATCAGAGCCCCTCCCTGCTTTTATAAG - UNI23347 - - 

UNI33498 - ATGAAGACAGGAAAAGACTGTGGTATATGAAACTTTGTTGACAAGAGAGGATCCAGAGACTTTAAAAGCAAAACTCTGCTGGGCATGGT

GACTCCTGTCTGTAATTCCAGCACTTGGCAGCCCAAG - UNI23118 - - UNI23347 - - UNI33498 - TCTTTGCAGATTCTTGAACCAGG

AATAGTAATCAACACTCATGGCCTTTTGACCCTCCTTCTCAGGATTCCAGCTTTCTCTCCTGGCCAGAAATGTTCAGCTTGGACTCATTCAGAAAAG - 

UNI16336 - ATCGGACCCAGCACAGGCAGCGTCAATGCAAGCTTCCCCCACCCCGTCTTCCACCCATGTGTGTCAACCCTGCCCCTGGAGGGACCATC

ACTCGAG - UNI20645 - CTTCTAGGGACCTATTAAAAGAGTTTCCGCAGCCTAAAAACCTTCTCAACAGCGTGATTGGAAGAGCCCTTGGCATCTC

ACATGCAAAAGACAAGTTAGTCTATGTGCACACGAATGGACCGAAGAAAAAG AAAGTCACCCTGCACATAAAGTGGCCCAAGAGCGTGGAGGTGGAAGG

CTATGGCAGCAAGAAGATTGATGCTGAGCGTCAGGCTGCAGCAGCTGCCTGCCAACTCTTCAAG GGCTGGGGTCTGCTGGGACCACGGAATGAGCTGTT

TGATGCAGCTAAATACCGAGTGCTAGCTGATCGTTTTGGGTCTCCAGCTGACAGCTGGTGGCGCCCAGAACCCACCATGCCTCCAACTTCCTGGCGGCAG

CTGAATCCTGAGAACATTCGGCCAGGGGGTCCTGCAGGACTATCCCGATCCTTAGGCCGAGAGGAAGAGGAAGATGAGGAGGAAGAGCTAGAAGAGGGGA

CCATTGATGTGACAGAGTTTCTGTCTATGACCCAGCAAGACTCCCACAACCCACTCAGGGACTCAAG GGGGGGCTCCTTTGAAATGACAGATGATGACA

GTGCTATCAGAGCTCTGACCCAGTTTCCACTTCCCAAGAACCTCCTGGCCAAAGTGATTCAGATTGCAACCTCCTCCTCCACAGCTAAG AATCTCATGC

AGTTCCATACTGTGGGTACCAAGACCAAGCTGGCTACACTCACTCTGCTCTGGCCCTGTCCCATGACCTTTGTTGCCAAAGGGCGACGCAAAGCTGAGGC

TGAGAATAAGGCAGCAGCCTTGGCTTGCAAGAAACTGAAG AGCCTTGGCCTTGTGGACAGGAACAATGAGCCGCTTACCCATGCCATGTACAACCTGGC

CTCCCTGCGTGAGTTGGGTGAGACCCAGCGCCGGCCATGTACCATCCAGGTGCCTGAGCCCATCCTTCGCAAGATAGAGGCCTTCCTGAGTCAT - UNI

28131 - TACCCGGTGGACAGCTCATGGATTTCCCCAGAACTCCGACTGCAGAGTGATGACATCTTGCCCTTAGGCAAGGACTCAGGGCCCTTGAGTGA

CCCTATCACAGGCAAGCCATACATGCCCCTGTCAGAAGCAGAGGAGGTGCGCTTAAGCCAGAGCCTGCTAGAGCTGTGGCGGAGGAGAGGGCCGATCTGG

CAGGAGGCCCCGCAGCTACCTGTAGACCCTCATCGGGACACTATCCTCAGTGCCATTGAACAACACCCAGTGGTAGTCATCTCTGGGGACACAGGCTGTG

GGAAGACCACACGTATCCCTCAGCTGCTATTGGAGCGCTATGTGACTGAGGGTCGAGGTGCCCGCTGCAATGTGATCATCACACAACCTCGCCGGATCTC

AGCTGTGTCTGTGGCACAGCGGGTCAGCCATGAACTGGGCCCCTCCTTGCGCCGGAATGTGGGCTTCCAGGTACGCTTGGAAAGTAAGCCCCCAGCCCGA

GGTGGGGCGCTGCTCTTCTGCACTGTGGGTATCCTGCTTCGGAAGCTGCAGAGCAACCCCAGCCTGGAGGGTGTGAGCCATGTCATTGTGGATGAGGTCC

ATGAGCGGGATGTGAACACAGACTTCCTGCTGATTCTGCTCAAGGGCCTGCAGCGGCTCAACCCAGCTCTTCGGCTGGTGCTCATGAGTGCTACAGGAGA

TAATGAGCGCTTTTCCCGATACTTTGGGGGCTGCCCTGTTATCAAGGTACCTGGCTTCATGTATCCCGTCAAGGAACACTACCTGGAGGACATCTTGGCC

AAGCTGGGTAAACATCAGTACCCACACCGGCATCGGCACCATGAG TCGGAAGATGAATGTGCACTTGATTTGGACCTTGTGACTGACCTGGTTCTGCAT

ATCGATGCCCGTGGGGAACCAG GTGGGATCCTGTGCTTTCTACCTGGCTGGCAAGAAATCAAAGGAGTGCAACAACGGCTCCAGGAGGCCCTGGGCATG

CATGAAAGCAAGTACCTCATCTTACCAG TGCACTCCAATATCCCCATGATGGACCAGAAGGCCATATTCCAACAGCCTCCACTTGGGGTACGCAAGATT

GTATTGGCCACCAACATTGCTGAAACCTCCATCACAGTTAACGACATTGTACATGTCGTGGACAGCGGTCTGCACAAGGAGGAACGCTATGACCTGAAGA

CCAAG - UNI35907 - GTGTCCTGCCTGGAGACTGTGTGGGTGTCGAGAGCAAATGTCATTCAGCGCCGGGGCAGGGCAGGCCGCTGCCAGTCAGGT

TTTGCCTACCACTTGTTCCCGAGGAGCCGGCTGGAGAAAATGGTTCCTTTCCAAGTGCCAGAGATCCTGCGCACACCTCTTGAGAACCTGGTGCTGCAAG

CCAAAATCCATATGCCTGAGAAGACG - UNI35907 - GCAGTGGAGTTCCTCTCTAAGGCTGTGGACAGTCCAAATATCAAGGCAGTGGATGAGGCC

GTGATCCTGCTCCAGGAGATTG - UNI35907 - GGGTGCTGGACCAGCGGGAGTATCTGACCACCTTGGGACAGCGCCTGGCCCACATCTCTACTGA

CCCCCGACTGGCCAAGGCCATAGTGTTGGCTGCCATCTTCCGTTGCCTGCACCCACTGCTGGTGGTTGTTTCCTGCCTTACCCGGGACCCCTTCAGCAGC

AGTTTGCAGAACCGGGCAGAAGTAGACAAG GTGAAGGCATTGCTGAGCCATGACAGTGGCAGTGACCATTTGGCCTTCGTGCGGGCTGTGGCTGGCTGG

GAGGAGGTACTGCGCTGGCAGGACCGTACCTCCAGGGAAAACTACCTGGAAGAAAACCTTCTGTATGCCCCCAGCTTGCGCTTCATCCACG GGCTCATC

AAGCAGTTCTCAGAGAACATTTATGAGGCTTTCCTAGTGGGGAAGCCCTCTGACTGCACACTGCCCTCTGCTCAGTGCAATGAGTACAGCGAGGAAGAGG

AGCTGGTGAAGGGTGTGCTGATGGCTGGCCTCTACCCCAACCTCATCCAG - UNI19988 - GTGAGACAAGGTAAGGTTACTCGGCAAGGCAAGTTC

AAACCCAACAGTGTCACTTACAGGACCAAATCTGGCAACATCTTGCTGCATAAGTCAACCATTAACAG - UNI24020 - GGAGGCTACCCGGTTACG

GAGCCGATGGCTGACATATTTCATGGCCGTCAAGTCCAATGGTAGCGTCTTTGTTCGAGATTCCTCCCAGGTGCACCCACTAGCTGTGTTGCTCCTAACA

GATGGGGACGTGCACATCCGAG ATGATGGGCGTCGGGCCACCATCTCATTGAGTGACAGCGACCTGCTTCGGCTGGAAGGTGATTCACGAACTGTGCGG

TTGCTAAGGGAGTTTCGTCGAGCCCTAGGACGGATGGTGGAGCGGAGCCTCCGCAGCGAGTTAGCTGCACTTCCTCTTAGTGTGCAGCAAGAACACGGGC

AGCTGCTTGCACTGCTGGCAGAGTTGCTTCGAGGACCTTGTGGCAGCTTTGATATGCGCAAGACAGCTGATGACTGAGCCTCTCTTCCGCTGGGGCTATG

TACAGAGTGCAAATGTTTATTTAAAATAAAGTTATATTTATCCCTTGTG
Translation
 - UNI10489 - - UNI33498 -  - UNI23347 - - UNI33498 -  - UNI23118 - - UNI23347 - - UNI33498 - MFSLDS

FRKD - UNI16336 - DRTQHRQRQCKLPPPRLPPMCVNPAPGGTITRA - UNI20645 - ASRDLLKEFPQPKNLLNSVIGRALGISHAKDKLVY

VHTNGPKKK KVTLHIKWPKSVEVEGYGSKKIDAERQAAAAACQLFK GWGLLGPRNELFDAAKYRVLADRFGSPADSWWRPEPTMPPTSWRQLNPENIR

PGGPAGLSRSLGREEEEDEEEELEEGTIDVTEFLSMTQQDSHNPLRDSR RGGSFEMTDDDSAIRALTQFPLPKNLLAKVIQIATSSSTAK NLMQFHTV

GTKTKLATLTLLWPCPMTFVAKGRRKAEAENKAAALACKKLK SLGLVDRNNEPLTHAMYNLASLRELGETQRRPCTIQVPEPILRKIEAFLSH - UNI

28131 - YPVDSSWISPELRLQSDDILPLGKDSGPLSDPITGKPYMPLSEAEEVRLSQSLLELWRRRGPIWQEAPQLPVDPHRDTILSAIEQHPVVVIS

GDTGCGKTTRIPQLLLERYVTEGRGARCNVIITQPRRISAVSVAQRVSHELGPSLRRNVGFQVRLESKPPARGGALLFCTVGILLRKLQSNPSLEGVSHV

IVDEVHERDVNTDFLLILLKGLQRLNPALRLVLMSATGDNERFSRYFGGCPVIKVPGFMYPVKEHYLEDILAKLGKHQYPHRHRHHE SEDECALDLDLV

TDLVLHIDARGEPG GGILCFLPGWQEIKGVQQRLQEALGMHESKYLILPV VHSNIPMMDQKAIFQQPPLGVRKIVLATNIAETSITVNDIVHVVDSGL

HKEERYDLKTK - UNI35907 - VSCLETVWVSRANVIQRRGRAGRCQSGFAYHLFPRSRLEKMVPFQVPEILRTPLENLVLQAKIHMPEKT - UNI

35907 - AVEFLSKAVDSPNIKAVDEAVILLQEIG - UNI35907 - GVLDQREYLTTLGQRLAHISTDPRLAKAIVLAAIFRCLHPLLVVVSCLTR

DPFSSSLQNRAEVDK VKALLSHDSGSDHLAFVRAVAGWEEVLRWQDRTSRENYLEENLLYAPSLRFIHG GLIKQFSENIYEAFLVGKPSDCTLPSAQC

NEYSEEEELVKGVLMAGLYPNLIQ - UNI19988 - VRQGKVTRQGKFKPNSVTYRTKSGNILLHKSTINR - UNI24020 - REATRLRSRWLTY

FMAVKSNGSVFVRDSSQVHPLAVLLLTDGDVHIRD DDGRRATISLSDSDLLRLEGDSRTVRLLREFRRALGRMVERSLRSELAALPLSVQQEHGQLLAL

LAELLRGPCGSFDMRKTADD
Transcript ENSMUST00000062368
Sequence
ATGGCGGCTGCCAGGCGGCTCATGGCGCTGGCTGCCGGCGTCTCTCCGCGCCTCCGGCCGCCGGATCCCCTTGTCGCTTCCGGGCGACAAGGATGTTCGC

GCGGCTTCTCATCAAGCTTTGTCCGCTCTGATGGCACTCAGGAAGCTGCCGAGGTCGAATCAGAGGTGGCCCCTAGCGAGCCTGGGGAGGGTGACGGAAG

CATGGTGAACG - UNI20645 - CTTCTAGGGACCTATTAAAAGAGTTTCCGCAGCCTAAAAACCTTCTCAACAGCGTGATTGGAAGAGCCCTTGGCA

TCTCACATGCAAAAGACAAGTTAGTCTATGTGCACACGAATGGACCGAAGAAAAAG AAAGTCACCCTGCACATAAAGTGGCCCAAGAGCGTGGAGGTGG

AAGGCTATGGCAGCAAGAAGATTGATGCTGAGCGTCAGGCTGCAGCAGCTGCCTGCCAACTCTTCAAG GGCTGGGGTCTGCTGGGACCACGGAATGAGC

TGTTTGATGCAGCTAAATACCGAGTGCTAGCTGATCGTTTTGGGTCTCCAGCTGACAGCTGGTGGCGCCCAGAACCCACCATGCCTCCAACTTCCTGGCG

GCAGCTGAATCCTGAGAACATTCGGCCAGGGGGTCCTGCAGGACTATCCCGATCCTTAGGCCGAGAGGAAGAGGAAGATGAGGAGGAAGAGCTAGAAGAG

GGGACCATTGATGTGACAGAGTTTCTGTCTATGACCCAGCAAGACTCCCACAACCCACTCAGGGACTCAAG GGGGGGCTCCTTTGAAATGACAGATGAT

GACAGTGCTATCAGAGCTCTGACCCAGTTTCCACTTCCCAAGAACCTCCTGGCCAAAGTGATTCAGATTGCAACCTCCTCCTCCACAGCTAAG AATCTC

ATGCAGTTCCATACTGTGGGTACCAAGACCAAGCTGGCTACACTCACTCTGCTCTGGCCCTGTCCCATGACCTTTGTTGCCAAAGGGCGACGCAAAGCTG

AGGCTGAGAATAAGGCAGCAGCCTTGGCTTGCAAGAAACTGAAG AGCCTTGGCCTTGTGGACAGGAACAATGAGCCGCTTACCCATGCCATGTACAACC

TGGCCTCCCTGCGTGAGTTGGGTGAGACCCAGCGCCGGCCATGTACCATCCAGGTGCCTGAGCCCATCCTTCGCAAGATAGAGGCCTTCCTGAGTCAT -

 UNI28131 - TACCCGGTGGACAGCTCATGGATTTCCCCAGAACTCCGACTGCAGAGTGATGACATCTTGCCCTTAGGCAAGGACTCAGGGCCCTTGA

GTGACCCTATCACAGGCAAGCCATACATGCCCCTGTCAGAAGCAGAGGAGGTGCGCTTAAGCCAGAGCCTGCTAGAGCTGTGGCGGAGGAGAGGGCCGAT

CTGGCAGGAGGCCCCGCAGCTACCTGTAGACCCTCATCGGGACACTATCCTCAGTGCCATTGAACAACACCCAGTGGTAGTCATCTCTGGGGACACAGGC

TGTGGGAAGACCACACGTATCCCTCAGCTGCTATTGGAGCGCTATGTGACTGAGGGTCGAGGTGCCCGCTGCAATGTGATCATCACACAACCTCGCCGGA

TCTCAGCTGTGTCTGTGGCACAGCGGGTCAGCCATGAACTGGGCCCCTCCTTGCGCCGGAATGTGGGCTTCCAGGTACGCTTGGAAAGTAAGCCCCCAGC

CCGAGGTGGGGCGCTGCTCTTCTGCACTGTGGGTATCCTGCTTCGGAAGCTGCAGAGCAACCCCAGCCTGGAGGGTGTGAGCCATGTCATTGTGGATGAG

GTCCATGAGCGGGATGTGAACACAGACTTCCTGCTGATTCTGCTCAAGGGCCTGCAGCGGCTCAACCCAGCTCTTCGGCTGGTGCTCATGAGTGCTACAG

GAGATAATGAGCGCTTTTCCCGATACTTTGGGGGCTGCCCTGTTATCAAGGTACCTGGCTTCATGTATCCCGTCAAGGAACACTACCTGGAGGACATCTT

GGCCAAGCTGGGTAAACATCAGTACCCACACCGGCATCGGCACCATGAG TCGGAAGATGAATGTGCACTTGATTTGGACCTTGTGACTGACCTGGTTCT

GCATATCGATGCCCGTGGGGAACCAG GTGGGATCCTGTGCTTTCTACCTGGCTGGCAAGAAATCAAAGGAGTGCAACAACGGCTCCAGGAGGCCCTGGG

CATGCATGAAAGCAAGTACCTCATCTTACCAG TGCACTCCAATATCCCCATGATGGACCAGAAGGCCATATTCCAACAGCCTCCACTTGGGGTACGCAA

GATTGTATTGGCCACCAACATTGCTGAAACCTCCATCACAGTTAACGACATTGTACATGTCGTGGACAGCGGTCTGCACAAGGAGGAACGCTATGACCTG

AAGACCAAG - UNI35907 - GTGTCCTGCCTGGAGACTGTGTGGGTGTCGAGAGCAAATGTCATTCAGCGCCGGGGCAGGGCAGGCCGCTGCCAGTC

AGGTTTTGCCTACCACTTGTTCCCGAGGAGCCGGCTGGAGAAAATGGTTCCTTTCCAAGTGCCAGAGATCCTGCGCACACCTCTTGAGAACCTGGTGCTG

CAAGCCAAAATCCATATGCCTGAGAAGACG - UNI35907 - GCAGTGGAGTTCCTCTCTAAGGCTGTGGACAGTCCAAATATCAAGGCAGTGGATGA

GGCCGTGATCCTGCTCCAGGAGATTG - UNI35907 - GGGTGCTGGACCAGCGGGAGTATCTGACCACCTTGGGACAGCGCCTGGCCCACATCTCTA

CTGACCCCCGACTGGCCAAGGCCATAGTGTTGGCTGCCATCTTCCGTTGCCTGCACCCACTGCTGGTGGTTGTTTCCTGCCTTACCCGGGACCCCTTCAG

CAGCAGTTTGCAGAACCGGGCAGAAGTAGACAAG GTGAAGGCATTGCTGAGCCATGACAGTGGCAGTGACCATTTGGCCTTCGTGCGGGCTGTGGCTGG

CTGGGAGGAGGTACTGCGCTGGCAGGACCGTACCTCCAGGGAAAACTACCTGGAAGAAAACCTTCTGTATGCCCCCAGCTTGCGCTTCATCCACG GGCT

CATCAAGCAGTTCTCAGAGAACATTTATGAGGCTTTCCTAGTGGGGAAGCCCTCTGACTGCACACTGCCCTCTGCTCAGTGCAATGAGTACAGCGAGGAA

GAGGAGCTGGTGAAGGGTGTGCTGATGGCTGGCCTCTACCCCAACCTCATCCAG - UNI19988 - GTGAGACAAGGTAAGGTTACTCGGCAAGGCAA

GTTCAAACCCAACAGTGTCACTTACAGGACCAAATCTGGCAACATCTTGCTGCATAAGTCAACCATTAACAG - UNI24020 - GGAGGCTACCCGGT

TACGGAGCCGATGGCTGACATATTTCATGGCCGTCAAGTCCAATGGTAGCGTCTTTGTTCGAGATTCCTCCCAGGTGCACCCACTAGCTGTGTTGCTCCT

AACAGATGGGGACGTGCACATCCGAG ATGATGGGCGTCGGGCCACCATCTCATTGAGTGACAGCGACCTGCTTCGGCTGGAAGGTGATTCACGAACTGT

GCGGTTGCTAAGGGAGTTTCGTCGAGCCCTAGGACGGATGGTGGAGCGGAGCCTCCGCAGCGAGTTAGCTGCACTTCCTCTTAGTGTGCAGCAAGAACAC

GGGCAGCTGCTTGCACTGCTGGCAGAGTTGCTTCGAGGACCTTGTGGCAGCTTTGATATGCGCAAGACAGCTGATGACTGAGCCTCTCTTCCGCTGGGGC

TATGTACAGAGTGCAAATGTTTATTTAAAATAAAGTTATATTTATCCCTTGTG
Translation
MAAARRLMALAAGVSPRLRPPDPLVASGRQGCSRGFSSSFVRSDGTQEAAEVESEVAPSEPGEGDGSMVNA - UNI20645 - ASRDLLKEFPQPKNL

LNSVIGRALGISHAKDKLVYVHTNGPKKK KVTLHIKWPKSVEVEGYGSKKIDAERQAAAAACQLFK GWGLLGPRNELFDAAKYRVLADRFGSPADSWW

RPEPTMPPTSWRQLNPENIRPGGPAGLSRSLGREEEEDEEEELEEGTIDVTEFLSMTQQDSHNPLRDSR RGGSFEMTDDDSAIRALTQFPLPKNLLAKV

IQIATSSSTAK NLMQFHTVGTKTKLATLTLLWPCPMTFVAKGRRKAEAENKAAALACKKLK SLGLVDRNNEPLTHAMYNLASLRELGETQRRPCTIQV

PEPILRKIEAFLSH - UNI28131 - YPVDSSWISPELRLQSDDILPLGKDSGPLSDPITGKPYMPLSEAEEVRLSQSLLELWRRRGPIWQEAPQLPV

DPHRDTILSAIEQHPVVVISGDTGCGKTTRIPQLLLERYVTEGRGARCNVIITQPRRISAVSVAQRVSHELGPSLRRNVGFQVRLESKPPARGGALLFCT

VGILLRKLQSNPSLEGVSHVIVDEVHERDVNTDFLLILLKGLQRLNPALRLVLMSATGDNERFSRYFGGCPVIKVPGFMYPVKEHYLEDILAKLGKHQYP

HRHRHHE SEDECALDLDLVTDLVLHIDARGEPG GGILCFLPGWQEIKGVQQRLQEALGMHESKYLILPV VHSNIPMMDQKAIFQQPPLGVRKIVLAT

NIAETSITVNDIVHVVDSGLHKEERYDLKTK - UNI35907 - VSCLETVWVSRANVIQRRGRAGRCQSGFAYHLFPRSRLEKMVPFQVPEILRTPLE

NLVLQAKIHMPEKT - UNI35907 - AVEFLSKAVDSPNIKAVDEAVILLQEIG - UNI35907 - GVLDQREYLTTLGQRLAHISTDPRLAKAIV

LAAIFRCLHPLLVVVSCLTRDPFSSSLQNRAEVDK VKALLSHDSGSDHLAFVRAVAGWEEVLRWQDRTSRENYLEENLLYAPSLRFIHG GLIKQFSEN

IYEAFLVGKPSDCTLPSAQCNEYSEEEELVKGVLMAGLYPNLIQ - UNI19988 - VRQGKVTRQGKFKPNSVTYRTKSGNILLHKSTINR - UNI2

4020 - REATRLRSRWLTYFMAVKSNGSVFVRDSSQVHPLAVLLLTDGDVHIRD DDGRRATISLSDSDLLRLEGDSRTVRLLREFRRALGRMVERSLR

SELAALPLSVQQEHGQLLALLAELLRGPCGSFDMRKTADD
Transcript ENSMUST00000084965
Sequence
GTAGTTGGGGGGGCCCGCGGCTCATGCGCCGTGCACCGAGGCTTGTTTCACATCTGTAACAACAG - UNI10489 - - UNI33498 - GAGGCCCA

GCCTCGTGATGAGGAATAGCAAGGAGAGAATTCAGCTCCAGTTTAAAAGCCTGCAAAATCAGAGCCCCTCCCTGCTTTTATAAG - UNI23347 - - 

UNI33498 - ATGAAGACAGGAAAAGACTGTGGTATATGAAACTTTGTTGACAAGAGAGGATCCAGAGACTTTAAAAGCAAAACTCTGCTGGGCATGGT

GACTCCTGTCTGTAATTCCAGCACTTGGCAGCCCAAG - UNI23118 - - UNI23347 - - UNI33498 - TCTTTGCAGATTCTTGAACCAGG

AATAGTAATCAACACTCATGGCCTTTTGACCCTCCTTCTCAGGATTCCAGCTTTCTCTCCTGGCCAGAAATGTTCAGCTTGGACTCATTCAGAAAAG - 

UNI16336 - ATCGGACCCAGCACAGGCAGCGTCAATGCAAGCTTCCCCCACCCCGTCTTCCACCCATGTGTGTCAACCCTGCCCCTGGAGGGACCATC

ACTCGAG - UNI20645 - CTTCTAGGGACCTATTAAAAGAGTTTCCGCAGCCTAAAAACCTTCTCAACAGCGTGATTGGAAGAGCCCTTGGCATCTC

ACATGCAAAAGACAAGTTAGTCTATGTGCACACGAATGGACCGAAGAAAAAG AAAGTCACCCTGCACATAAAGTGGCCCAAGAGCGTGGAGGTGGAAGG

CTATGGCAGCAAGAAGATTGATGCTGAGCGTCAGGCTGCAGCAGCTGCCTGCCAACTCTTCAAG GGCTGGGGTCTGCTGGGACCACGGAATGAGCTGTT

TGATGCAGCTAAATACCGAGTGCTAGCTGATCGTTTTGGGTCTCCAGCTGACAGCTGGTGGCGCCCAGAACCCACCATGCCTCCAACTTCCTGGCGGCAG

CTGAATCCTGAGAACATTCGGCCAGGGGGTCCTGCAGGACTATCCCGATCCTTAGGCCGAGAGGAAGAGGAAGATGAGGAGGAAGAGCTAGAAGAGGGGA

CCATTGATGTGACAGAGTTTCTGTCTATGACCCAGCAAGACTCCCACAACCCACTCAGGGACTCAAG GGGGGGCTCCTTTGAAATGACAGATGATGACA

GTGCTATCAGAGCTCTGACCCAGTTTCCACTTCCCAAGAACCTCCTGGCCAAAGTGATTCAGATTGCAACCTCCTCCTCCACAGCTAAG AATCTCATGC

AGTTCCATACTGTGGGTACCAAGACCAAGCTGGCTACACTCACTCTGCTCTGGCCCTGTCCCATGACCTTTGTTGCCAAAGGGCGACGCAAAGCTGAGGC

TGAGAATAAGGCAGCAGCCTTGGCTTGCAAGAAACTGAAG AGCCTTGGCCTTGTGGACAGGAACAATGAGCCGCTTACCCATGCCATGTACAACCTGGC

CTCCCTGCGTGAGTTGGGTGAGACCCAGCGCCGGCCATGTACCATCCAGGTGCCTGAGCCCATCCTTCGCAAGATAGAGGCCTTCCTGAGTCAT - UNI

28131 - TACCCGGTGGACAGCTCATGGATTTCCCCAGAACTCCGACTGCAGAGTGATGACATCTTGCCCTTAGGCAAGGACTCAGGGCCCTTGAGTGA

CCCTATCACAGGCAAGCCATACATGCCCCTGTCAGAAGCAGAGGAGGTGCGCTTAAGCCAGAGCCTGCTAGAGCTGTGGCGGAGGAGAGGGCCGATCTGG

CAGGAGGCCCCGCAGCTACCTGTAGACCCTCATCGGGACACTATCCTCAGTGCCATTGAACAACACCCAGTGGTAGTCATCTCTGGGGACACAGGCTGTG

GGAAGACCACACGTATCCCTCAGCTGCTATTGGAGCGCTATGTGACTGAGGGTCGAGGTGCCCGCTGCAATGTGATCATCACACAACCTCGCCGGATCTC

AGCTGTGTCTGTGGCACAGCGGGTCAGCCATGAACTGGGCCCCTCCTTGCGCCGGAATGTGGGCTTCCAGGTACGCTTGGAAAGTAAGCCCCCAGCCCGA

GGTGGGGCGCTGCTCTTCTGCACTGTGGGTATCCTGCTTCGGAAGCTGCAGAGCAACCCCAGCCTGGAGGGTGTGAGCCATGTCATTGTGGATGAGGTCC

ATGAGCGGGATGTGAACACAGACTTCCTGCTGATTCTGCTCAAGGGCCTGCAGCGGCTCAACCCAGCTCTTCGGCTGGTGCTCATGAGTGCTACAGGAGA

TAATGAGCGCTTTTCCCGATACTTTGGGGGCTGCCCTGTTATCAAGGTACCTGGCTTCATGTATCCCGTCAAGGAACACTACCTGGAGGACATCTTGGCC

AAGCTGGGTAAACATCAGTACCCACACCGGCATCGGCACCATGAG TCGGAAGATGAATGTGCACTTGATTTGGACCTTGTGACTGACCTGGTTCTGCAT

ATCGATGCCCGTGGGGAACCAGGTGGGTGCTTCCTCCCAC CAGTGCACTCCAATATCCCCATGATGGACCAGAAGGCCATATTCCAACAGCCTCCACTT

GGGGTACGCAAGATTGTATTGGCCACCAACATTGCTGAAACCTCCATCACAGTTAACGACATTGTACATGTCGTGGACAGCGGTCTGCACAAGGAGGAAC

GCTATGACCTGAAGACCAAGGTGGCGCCTCTCTCTTGGGCCCAACTAACCCACTGGGGAATGATTCCAG - UNI35907 - TGCTGGACCAGCGGGAG

TATCTGACCACCTTGGGACAGCGCCTGGCCCACATCTCTACTGACCCCCGACTGGCCAAGGCCATAGTGTTGGCTGCCATCTTCCGTTGCCTGCACCCAC

TGCTGGTGGTTGTTTCCTGCCTTACCCGGGACCCCTTCAGCAGCAGTTTGCAGAACCGGGCAGAAGTAGACAAG GTGAAGGCATTGCTGAGCCATGACA

GTGGCAGTGACCATTTGGCCTTCGTGCGGGCTGTGGCTGGCTGGGAGGAGGTACTGCGCTGGCAGGACCGTACCTCCAGGGAAAACTACCTGGAAGAAAA

CCTTCTGTATGCCCCCAGCTTGCGCTTCATCCACGGTCAGCCTG GGCTCATCAAGCAGTTCTCAGAGAACATTTATGAGGCTTTCCTAGTGGGGAAGCC

CTCTGACTGCACACTGCCCTCTGCTCAGTGCAATGAGTACAGCGAGGAAGAGGAGCTGGTGAAGGGTGTGCTGATGGCTGGCCTCTACCCCAACCTCATC

CAG - UNI19988 - GTGAGACAAGGTAAGGTTACTCGGCAAGGCAAGTTCAAACCCAACAGTGTCACTTACAGGACCAAATCTGGCAACATCTTGCT

GCATAAGTCAACCATTAACAGGTGGGTGGCAACCAGGGTTACATACAGAGGGACTCAGAGAATGACCAGATGTGTAGCTTCACACAGCATTTTGTTCCCC

AGGGAGGCTACCCGGTTACGGAGCCGATGGCTGACATATTTCATGGCCGTCAAGTCCAATGGTAGCGTCTTTGTTCGAGATTCCTCCCAGGTGCACCCAC

TAGCTGTGTTGCTCCTAACAGATGGGGACGTGCACATCCGA
Translation
 - UNI10489 - - UNI33498 -  - UNI23347 - - UNI33498 -  - UNI23118 - - UNI23347 - - UNI33498 - QDSSFL

SWPEMFSLDSFRKD - UNI16336 - DRTQHRQRQCKLPPPRLPPMCVNPAPGGTITRA - UNI20645 - ASRDLLKEFPQPKNLLNSVIGRALG

ISHAKDKLVYVHTNGPKKK KVTLHIKWPKSVEVEGYGSKKIDAERQAAAAACQLFK GWGLLGPRNELFDAAKYRVLADRFGSPADSWWRPEPTMPPTS

WRQLNPENIRPGGPAGLSRSLGREEEEDEEEELEEGTIDVTEFLSMTQQDSHNPLRDSR RGGSFEMTDDDSAIRALTQFPLPKNLLAKVIQIATSSSTA

K NLMQFHTVGTKTKLATLTLLWPCPMTFVAKGRRKAEAENKAAALACKKLK SLGLVDRNNEPLTHAMYNLASLRELGETQRRPCTIQVPEPILRKIEA

FLSH - UNI28131 - YPVDSSWISPELRLQSDDILPLGKDSGPLSDPITGKPYMPLSEAEEVRLSQSLLELWRRRGPIWQEAPQLPVDPHRDTILSA

IEQHPVVVISGDTGCGKTTRIPQLLLERYVTEGRGARCNVIITQPRRISAVSVAQRVSHELGPSLRRNVGFQVRLESKPPARGGALLFCTVGILLRKLQS

NPSLEGVSHVIVDEVHERDVNTDFLLILLKGLQRLNPALRLVLMSATGDNERFSRYFGGCPVIKVPGFMYPVKEHYLEDILAKLGKHQYPHRHRHHE SE

DECALDLDLVTDLVLHIDARGEPGGCFLPP PVHSNIPMMDQKAIFQQPPLGVRKIVLATNIAETSITVNDIVHVVDSGLHKEERYDLKTKVAPLSWAQL

THWGMIPV - UNI35907 - VLDQREYLTTLGQRLAHISTDPRLAKAIVLAAIFRCLHPLLVVVSCLTRDPFSSSLQNRAEVDK VKALLSHDSGSDH

LAFVRAVAGWEEVLRWQDRTSRENYLEENLLYAPSLRFIHGQPG GLIKQFSENIYEAFLVGKPSDCTLPSAQCNEYSEEEELVKGVLMAGLYPNLIQ -

 UNI19988 - VRQGKVTRQGKFKPNSVTYRTKSGNILLHKSTINRWVATRVTYRGTQRMTRCVASHSILFPREATRLRSRWLTYFMAVKSNGSVFVRD

SSQVHPLAVLLLTDGDVHIR

For any suggestions or comments, please send an email to unitrap@crg.es