Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032491 (Nradd)
Chromosomal location
Chr 9: 110523642 - 110526882 (-)
Description
neurotrophin receptor associated death domain Gene [Source:MGI Symbol;Acc:MGI:1914419]
RefSeq_dna
NM_026012 
RefSeq_peptide
NP_080288.1 
UniGene
Mm.46680 
MGI
MGI:1914419 
Uniprot/SPTREMBL
Q3TVC1 Q8CHQ4 Q8CJ26 Q9CVM2 
Human Ortholog
not available
Omim not available
UniTrap UNI15873
Vector Insertion
Chr 9: 110525740 - 110526818
Public Clones (cmhd) CMHD-GT_418G2-3 (cmhd) IST14629F7 (tigm) IST14729B5 (tigm)
IST14562A1 (tigm) IST15001A3 (tigm)
Private Clones OST471205 (lexicon) OST432114 (lexicon) OST337025 (lexicon) OST325598 (lexicon)
OST232622 (lexicon) OST53696 (lexicon) OST49016 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23800
Vector Insertion
Chr 9: 110524766 - 110525590
Public Clones not available
Private Clones OST244500 (lexicon) OST109279 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035069
Sequence
AGGGACTCCCGTCGTCTTCCTAGCTGAGTGGATCCTGGCACCCTCGGAGGGGTGGCCGCAGAAG - UNI15873 - AGTTCCTCCTTCTGAGATTCAA

GAGAAGCAGGCTCCAAGCTCCGTCAACTCAGTTCTCTACACAACTCCCCTTCACCAAAAAACAGCCCAGCAGGCAGCGCCTGGCAGCACCATGCTTTATA

ACGTCAGCAAAGGTGTGGTCTATTCAG - UNI23800 - ATACAGCCCTGCAGGGGCAGGACGGGGACAGGGAAGGAATGTGGGTAGGAGCTGGGGGA

GCCCTAGCCCCCAATACCTCCTCCCTATTTCCCCCTGAGCCTCCAGGGGCCTCGAGCAACATCATTCCTGTCTACTGTGCTCTCCTAGCTACAGTGATCC

TTGGTCTGCTGGCCTATGTGGCCTTCAAATG CTGGCGCTCACATAAGCAAAGGCAACAGTTGGCTAAAGCTCGGACTGTAGAGCTAGGGGACCCTGACA

GGGACCAGAGGCGTGGTGACAGCAACGTCTTCGTGGACTCTCCTCCTAGTCTGGAGCCCTGTATTCCCAGCCAGG GACCACACCCGGACCTTGGCTGCC

AGCTTTACCTGCATATTCCACAGCAGCAGCAGGAGGAAGTCCAGCGGCTCCTGATGATGGGTGAGCCAGCCAAGGGCTGGCAGGAGCTGGCAGGCCACCT

CGGCTACCAAGCTGAGGCTGTGGAAACCATGGCCTGTGACCAAATGCCAGCCTATACCCTGCTAAGGAACTGGGCTGCCCAAGAAGGCAATAGAGCTACC

CTCAGAGTGCTGGAGGATGCTCTGGCTGCCATAGGCCGAGAAGATGTGGTCCAGGTTTTGAGCTCGCCAGCTGAGAGCTCCTCGGTGGTGTGAGTGCCGC

CTCCCAGGGCTGCCTGCCCTGGCCTCATGTCTTTCATGGGCTTCCTAGTACTTCTCTGGCTTCAGCTTGCTGTTGTGGCAGCAGAACACAAAAGATCCGG

CCACTTCATGTTCCTTCTCCATCCTCTCCAAGATAGAAGCGAGGGACATGGGGGGGTGGGTAAGAGAGTGGGCATGGCTTTGCCCACAGATTCTCGTTCT

GCCCCTTTATGTGCTTGTTATTTTTTCTATTTCTTTTTAAGAATCACATATTAAAGGCACCTTTGGAGTTTTGTTC
Translation
 - UNI15873 - MLYNVSKGVVYSD - UNI23800 - DTALQGQDGDREGMWVGAGGALAPNTSSLFPPEPPGASSNIIPVYCALLATVILGLLAY

VAFKC CWRSHKQRQQLAKARTVELGDPDRDQRRGDSNVFVDSPPSLEPCIPSQG GPHPDLGCQLYLHIPQQQQEEVQRLLMMGEPAKGWQELAGHLGY

QAEAVETMACDQMPAYTLLRNWAAQEGNRATLRVLEDALAAIGREDVVQVLSSPAESSSVV

For any suggestions or comments, please send an email to unitrap@crg.es