Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032493 (1700036D21Rik)
Chromosomal location
Chr 9: 110716512 - 110726897 (+)
Description
RIKEN cDNA 1700036D21 gene Gene [Source:MGI Symbol;Acc:MGI:1920586]
Human Ortholog
not available
Omim not available
UniTrap UNI36289
Vector Insertion
Chr 9: 110720502 - 110726801
Public Clones IST13674B4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098345
Sequence
CGCTACAACAGGTTGAGGCCTTGGCGGTGGCATGGCCTTCCAGGGCTGTGACTGCTTCGGCCTTTTGGTCTGGCTCTTGCTGCTTCAGACGCGATTGGGC

AAGGCTCGTATGGTTCCAGGGACGCCGTCTCTTTCTCCTCTCCCCTCAGAGAATGGCCTAGATGACTCGGGTGTAAACCCACAAGAGAGGCCACTCACAG

GGATGCCTGAGACCTCGTTGCCCCGCAAGCCTGGGGACAGCACGAGGCCCCTTGATTCGATGGCATTTACTCCAGGTCAATCTTTTTCAACCATGAGTCT

GTCAAGACAACCGTTTCCAACATGGGTTCCACCCACTTCAG CTTGTGGCCACAGAACTGCAAGGATAGTTGGTGGAAGGCCTGCGCCAGCGAGGAAGTG

GCCGTGGCAGGTGAGCCTGCAGGTCCACAAGCAGCACATCTGTGGTGGCTCCCTCATCAGCAAATGGTGGGTGATTACAGCAGCCCACTGTGTATATGG 

ACATCTGGATTATGCAGTGTTCATGGGAGATGCTGACTTGTGGTCCAAAAGGCCAGTCAGGATTCCAGTCCAGGACATCATCGTTCACCAGGATTTCTCC

ATGATGAGAACAGTTGTTCATGACATCGCCCTTGTTCTGCTGGCCTTCCCTGTGAATTACAGCGTCAACATCCAGCCCGTGTGCATCCCTGAAAAGTCTT

TCTTGGTACAACCTGGGACGCTATGCTGGGTGACCGGATGGGGCAAAGTACTTGAACAAG GTAGGTCGTCGAGAATACTGCAGGAGATTGAGCTGAATA

TTATCCGTCATGAGAAATGTAACCAGATTCTCAAGGACATCATGGGGAATATATTTACCCTGGTCCAGGAAGGGGGAGTCTGTGGCTATAATGAGAAAGG

AGGAGATGCCTGCCAG GGAGATTCTGGGGGCCCCCTGGTCTGCGAATTTAATAAAACGTGGGTGCAGGTAGGGATCGTGAGCTGGGGTCTTGGCTGTGG

CCGAATTGGATACCCTGGAGTTTATACAGAAGTGAGTTACTACAGAGACTGGATCATTAAAGAACTGAGTCGGGCTTCGTGTTGGAAGCTATCAGGCTTC

CTCGTCTTAAGCGTGTGTCTGGTGCTTCACCTGGCCATCGTGGTGGCCCTATGATCCCCACAGCCCATGGTCCTCTTGTTTCTGAGCCTTCACTAGCTTC

TCCCCTGACCGGATTTCCCCACCAATGCTTTCTTCAAATTCTACTTGGGATTGCTTGCCTTAGTGGAGCAGGAACACTGGAGGGAGTTTGGGGCTTGTAA

GCATGTCCCGCCCTGGTGCTCTTTGTCATCTGCCTCAGATACCACTGTACTAAGGCTGTGCTTTACCTGGAGTGAAGGATTGTGGCCCACTTCCCGATAG

AGGACTATCTGGCCTGCCAGGTGGAGGGAGATAACTCATCTTGTGAGTTATCTTGGAAAAAAGAACATCTCTAGAGGAGAGACTTCATCAGGACTGAGTG

GGCACCGGGTCTAACTGATTTCATCAGGATTGAGTGGGCACTGGGTCTGTCTATTAGTCACTCTCACCAGAGACTCTAGAATACCAGTGAGATCTGTGGC

CACACACAGACAGAGGAGGCATTTCCTGCAGAGGTGTGAGGCTGGTGGGAATCCATCTGTGAGTACAAAACTTTTGCTACACAACCTCCTGGGAGCAACC

CTGTCTGGTGCCGCCTTCAACAGTTCCCACACAGCCACCTCCAGGGCCACCGCAAGTTGTGGTGGTGCAGTTTTGGAGAGGATAGATGTTAGATGTTGAC

TGAATAAACATGTCTCATGTGTTCTG
Translation
MAFQGCDCFGLLVWLLLLQTRLGKARMVPGTPSLSPLPSENGLDDSGVNPQERPLTGMPETSLPRKPGDSTRPLDSMAFTPGQSFSTMSLSRQPFPTWVP

PTSA ACGHRTARIVGGRPAPARKWPWQVSLQVHKQHICGGSLISKWWVITAAHCVYG GHLDYAVFMGDADLWSKRPVRIPVQDIIVHQDFSMMRTVVH

DIALVLLAFPVNYSVNIQPVCIPEKSFLVQPGTLCWVTGWGKVLEQG GRSSRILQEIELNIIRHEKCNQILKDIMGNIFTLVQEGGVCGYNEKGGDACQ

 GDSGGPLVCEFNKTWVQVGIVSWGLGCGRIGYPGVYTEVSYYRDWIIKELSRASCWKLSGFLVLSVCLVLHLAIVVAL
Transcript ENSMUST00000011392
Sequence
CGCTACAACAGGTTGAGGCCTTGGCGGTGGCATGGCCTTCCAGGGCTGTGACTGCTTCGGCCTTTTGGTCTGGCTCTTGCTGCTTCAGACGCGATTGGGC

AAGGCTCGTATGGTTCCAGGGACGCCGTCTCTTTCTCCTCTCCCCTCAGAGAATGGCCTAGATGACTCGGGTGTAAACCCACAAGAGAGGCCACTCACAG

GGATGCCTGAGACCTCGTTGCCCCGCAAGCCTGGGGACAGCACGAGGCCCCTTGATTCGATGGCATTTACTCCAGGTCAATCTTTTTCAACCATGAGTCT

GTCAAGACAACCGTTTCCAACATGGGTTCCACCCACTTCAG CTTGTGGCCACAGAACTGCAAGGATAGTTGGTGGAAGGCCTGCGCCAGCGAGGAAGTG

GCCGTGGCAGGTGAGCCTGCAGGTCCACAAGCAGCACATCTGTGGTGGCTCCCTCATCAGCAAATGGTGGGTGATTACAGCAGCCCACTGTGTATATGG 

ACATCTGGATTATGCAGTGTTCATGGGAGATGCTGACTTGTGGTCCAAAAGGCCAGTCAGGATTCCAGTCCAGGACATCATCGTTCACCAGGATTTCTCC

ATGATGAGAACAGTTGTTCATGACATCGCCCTTGTTCTGCTGGCCTTCCCTGTGAATTACAGCGTCAACATCCAGCCCGTGTGCATCCCTGAAAAGTCTT

TCTTGGTACAACCTGGGACGCTATGCTGGGTGACCGGATGGGGCAAAGTACTTGAACAAG GTAGGTCGTCGAGAATACTGCAGGAGATTGAGCTGAATA

TTATCCGTCATGAGAAATGTAACCAGATTCTCAAGGACATCATGGGGAATATATTTACCCTGGTCCAGGAAGGGGGAGTCTGTGGCTATAATGAGAAAGG

AGGAGATGCCTGCCAG GGAGATTCTGGGGGCCCCCTGGTCTGCGAATTTAATAAAACGTGGGTGCAGGTAGGGATCGTGAGCTGGGGTCTTGGCTGTGG

CCGAATTGGATACCCTGGAGTTTATACAGAA - UNI36289 - GTGGCATCTCCCAATGATACGGCACTTCCCCCGACCCACCGTGCTCATTGCCCTC

AAGACTGCTTCCAGGACCCACGCTTGGCAAAAATGGAATAA
Translation
  MGDADLWSKRPVRIPVQDIIVHQDFSMMRTVVHDIALVLLAFPVNYSVNIQPVCIPEKSFLVQPGTLCWVTGWGKVLEQG GRSSRILQEIELNIIRH

EKCNQILKDIMGNIFTLVQEGGVCGYNEKGGDACQ GDSGGPLVCEFNKTWVQVGIVSWGLGCGRIGYPGVYTE - UNI36289 - VASPNDTALPPT

HRAHCPQDCFQDPRLAKME

For any suggestions or comments, please send an email to unitrap@crg.es