Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032497 (Lrrfip2)
Chromosomal location
Chr 9: 111020639 - 111127829 (+)
Description
leucine rich repeat (in FLII) interacting protein 2 Gene [Source:MGI Symbol;Acc:MGI:1918518]
RefSeq_dna
NM_027742 
RefSeq_peptide
NP_082018.1 
UniGene
Mm.302287 
MGI
MGI:1918518 
Uniprot/SWISSPROT
Q91WK0 
Uniprot/SPTREMBL
Q8C062 
Human Ortholog
ENSG00000093167 (LRRFIP2)
Omim not available
UniTrap UNI3824
Vector Insertion
Chr 9: 111022216 - 111043693
Public Clones AY0497 (sanger) (sanger) IST14998H7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7156
Vector Insertion
Chr 9: 111043837 - 111063806
Public Clones RRR455 (baygenomics) IST14858B12 (tigm)
Private Clones OST232785 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7894
Vector Insertion
Chr 9: 111063806 - 111063894
Public Clones RRM042 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7132
Vector Insertion
Chr 9: 111092789 - 111095550
Public Clones RRJ507 (baygenomics) RRU377 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2501
Vector Insertion
Chr 9: 111102340 - 111108258
Public Clones XT0265 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4552
Vector Insertion
Chr 9: 111108352 - 111110300
Public Clones AG0127 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1814
Vector Insertion
Chr 9: 111118483 - 111122185
Public Clones CA0133 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098339
Sequence
AGCTGCAGCCGCTGCTCGGGCTGCGGCTCGTCCCGGGTCGCGTTCGCTGTGTCGGCCGCGGGGCGAAGGGCGCGCTCAGTGTGACTCCACGACCGGCCGC

GGCGCGAGGAGCCCTTCTTTTTGTCTCCCTGCGGCCCGCGGGGTGGACGGTGCGGGGGGGTGCAGAGTGTGGCCGGCGCTCTCCTCTCCCGGCTCCCGGG

CGGCCGCTCCGGCCCTTCCGGGCGGCGCCGCAGCCTCATCCCGCGCCACACGCAG ATGTGGGAAGACAAATGAAGGGATTTAGAAGCCAAGTAAATGTC

ATTGGGAAGGAGAGCTACCACCACTGAG - UNI3824 - TGCTGAACAGTAAACTCATTTTTCAGAGTTAAAAAATTATTTAAAAAAACAAGATGGGG

ACTCCTGGTTCTGGAAGGAAAAGAACGCCGGTAAAAGATCGATTTTCTGCAGAAGATGAAGCTTTGAGTAACATCGCCAGAGAG - UNI7156 - - U

NI7894 - GCAGAAGCAAGGCTAGCAGCAAAGCGGGCCGCCAGGGCAGAAGCAAGAGACATCCGCATGCGGGAACTGGAACGACAGCAGAGAGAGGTAA

CG CATCATTCCTTTGACCGGAAATGGGGAGAGATTCACAAGTGGCTG GAAGATTCAGAAAGGGCCAGGTACTCTCACCGGTCTGGTCACCGCCGTCCT

TACCTG GGAGTTGAGGATACATTGTCTCTTCGGAGCCTTGGCAGTCACAGG TATGATACCATCAAGGACAGACCATCAAGAGTTTCGTCATTA AATC

ATTCTTACAGTCACACCCATGGGACGAAGAAGCGATCCTCTAGTTCTTATAAAGATCCACTG AGTGGCCTCTACTTTGACCAGAGAAACTATAGCAGTC

TTAGACATAGCAAACCTGCCTCTACCTACTATTTACGG CAGTCTTCTTCCCTGTGCAGTGAGCCGATGGGGACACCCAAGAGTCAGAGCAGG GCCTCC

CCTACTGTAACTTCTGGTCTGCTGAGGAGTACCAGTCTG GCATCTCTGTATGATGGCGGATTATATAACCCTTATGGTTCTCGAACT CCGTCCGAATA

CAGTTACTACTCATCCAGGGCAAGTTCCTCCAGAAGCAGTCCTGTG CCCATCGATGATGATACCGCAAGCATTGTGTCTTCTGATCGTGCCAGTCGTGG

GCGAAGGGAGAGTGTG GTTTCTGCTGCTGATTACTTTAGTCGCTCCAATCGTAGGGGAAGCGTTGTCTCTGAGGTGGATGATGCCGGCATCTCAGACTT

GACTAGC TTGGATGAAAAATCTGACAAACAGTATGCTGAAAACTACACAAGA CCTTCATCTCGAAATTCTGCCTCGGCTACAACGCCTCTAAGTGGGA

ACTCATCCAGACGGGGTAGTGGGGACACCAGCAGCTTAATAGACCCAGACACCTCACTGAGTGAACTGCGG - UNI7132 - GACATCTATGACCTGA

AGGACCAGATTCATGATGTAGAAGGGCGGTACATGCAGGGCCTTAAGGAACTGAAG GAGTCTTTGTCTGAAGTAGAAGAGAAATACAAGAAAGCCATGG

TGTCCAATGCACAACTAGACAATGAGAAGAACAATCTGATCTACCAGGTGGACACCCTCAAGGATGTCATTGAAGAGCAGGAGGAGCAGATGGCAGAGTT

TTATAGAGAGAACGAAGAGAAGTCAAAG - UNI2501 - GAGTTAGAAAGGCAGAAACACATGTGCAGCGTGCTGCAGCATAAGATGGATGAACTCAA

AGAAGGCCTTCGGCAGAGGGACGAGCTCATCGAG - UNI4552 - GAGAATCAGCGCCTCCAGCAGAAAGTAGACACCATGACAAAAGAGGTGTTTGA

CCTCCAAGAGACCCTGCTCTGGAAAGATAAAGCACTTGGG GCCCTAGAGAAACAGAAAGAACACATTGCCTGCCTCAGGAATGAGCGAGATGTGCTCAG

AGAGGAGCTGGCTGACCTGCGGCAGACAGTGACGACAGCAGAG AAACATGGCTTAGTTATAATCCCAGACAGCACTCCCAATGGTGATGTCCATCATGA

GCCTGTGGTTGGAGCCATTACTGCTGTGTCTCAGGAAGCTGCTCAGGTCTTGGAGTCAGCAGGAGAAGGGCCACTAG ATGTGAGGCTACGAAAGCTTGC

TGGAGAAAAGGACGAGCTCTTGTCACAG - UNI1814 - ATTAGAAAACTGAAGCTCCAGTTAGAGGAAGAACGGCAGAAGTGTTCCAGGAATGATGG

CATGTCCGGGGACCTGGCAGGACTGCAGAACGGCTCAGACTTGCAGTTCATCGAGATGCAGA GAGATGCCAATAGACAAATTAGTGAATACAAATTCAA

GCTTTCGAAAGCAGAACAAGACATAGCTACCTTGGAACAAAGT ATCAGCCGGCTTGAGGGGCAGGTGCTGAGGTACAAAACTGCTGCTGAGAATGCAGA

GAAAATTGAAGATGAGCTGAAAGCAGAAAGGAGGAAGCTACAGCGAGAG CTACGGACGGCACAGGACAAGATAGAGGAGATGGAGATGACCAACAGCCA

CCTGGCTAAGCGGCTAGAGAAGATGAAAGCCAACAGGACAGCCCTTCTAGCCCAGCAGTAGGAGGCGGCCCTTCTACCTGGGTGCTGCTGAGGACCTTGC

CGGGAGATGCTGACTCTTTTGTACATTGACACAAGCCCCTTCAAGTACTGTTTTGAGTCTTGTCATTAAACAGCCACCTTTGTATTTTATAATTTATGAG

AATGAAGCAGGTTTAATCGTTAATGGATTTGGATTTTGTTTGTAGTTCACTTCTACAGTGAGAACTAGTCTGTGCTGTCTTTATTTTCAACATTCTAGAA

TCACGTTTTCTCACCATCTTCTTCCTGCCGCCTCGCTGACAGAGGCACTGGGTGGCCTTGCTGTGGGTTCTGGAGGATGGCCATTCTGAGCACTGAGACA

CTTGCTGGAGACCTCAAAAACCCAAGTGCCTTCTCCAAAGTGTGATGCAGGCTTCAGAGACCAATGGCCAAGGTTCCTCCTCTTCTTACCAGAGTGTTTA

CATTTCAGTGAGGATGTGTTCAGCAGTGGGGAGTCTGTTTCACTCAAATTTATGTTTGGAGGAAAAACCTTTTTTTTTTTTTGAGGGTAAGATATTTAAA

TTATATAAAAGTTTTAGAAAACAATATGGGGAGTGTATATTAAACTTTGCTACATGGGGCAGAGCAAGTCCAAGCCTGTACTCCAAAGACTAGGCTCCTC

AGTCTTCACACCCACTGTGCTGTTCCGTGCGTTTTCATCTGCTGCTTACCTGTGAATGAAGCCTCAGACAAGCTCAAGGGAGGAGGGAGGGACAGTGCAG

GCAGGCAGGGAATCCGCCTGAATCTACCTACTAAAACACACCTTTCTGCCATCCACGATTGGCTGAGGGCAGTCGATGTTAAAGAAGCCTTTAGGACAAG

TCATGGCTACCATGTACAGTCTTGCTCTTCTTTTCTCAAGATGAGATACTCTGGGATACAGAACTTTCTTCTAGTTTTTTGAGAGAAAGGATCGATGTAG

CCCGGCTGGCCTCCACCTCACAATCATCCTCATTGGGCCTCTTTGAGTGCTGGGATTCCAGGCAGGTACTTTCATACCTGGTTCCAGAATATAAAGTCCT

TAAGAACTTTCATCTTTAAAGAGCCCAGTTCAAGATACCCCTGCCCCTGCTGTAACCACTTTATAGGGTTTGTGATTCTCATTTGTCAGAATCAAGGTGG

TTTCATGGGAATGATTACTATAGCTCAAAGTGTTTACAGAAACTATATTGAGGAAAAAATCTAATGAATCAAAGCCTCTTAATAAATCTAGCCTTGGAAC

TAGATAATAAAATTAACTCAAAAGTG
Translation
  - UNI3824 - MGTPGSGRKRTPVKDRFSAEDEALSNIARE - UNI7156 - - UNI7894 - AEARLAAKRAARAEARDIRMRELERQQREVT

 HHSFDRKWGEIHKWL EDSERARYSHRSGHRRPYL GVEDTLSLRSLGSHR YDTIKDRPSRVSSL NHSYSHTHGTKKRSSSSYKDPL SGLYFDQRN

YSSLRHSKPASTYYLR QSSSLCSEPMGTPKSQSR ASPTVTSGLLRSTSL ASLYDGGLYNPYGSRT PSEYSYYSSRASSSRSSPV PIDDDTASIVS

SDRASRGRRESV VSAADYFSRSNRRGSVVSEVDDAGISDLTS LDEKSDKQYAENYTR PSSRNSASATTPLSGNSSRRGSGDTSSLIDPDTSLSELR 

- UNI7132 - DIYDLKDQIHDVEGRYMQGLKELK ESLSEVEEKYKKAMVSNAQLDNEKNNLIYQVDTLKDVIEEQEEQMAEFYRENEEKSK - UNI

2501 - ELERQKHMCSVLQHKMDELKEGLRQRDELIE - UNI4552 - ENQRLQQKVDTMTKEVFDLQETLLWKDKALG ALEKQKEHIACLRNERD

VLREELADLRQTVTTAE KHGLVIIPDSTPNGDVHHEPVVGAITAVSQEAAQVLESAGEGPLD DVRLRKLAGEKDELLSQ - UNI1814 - IRKLKL

QLEEERQKCSRNDGMSGDLAGLQNGSDLQFIEMQR RDANRQISEYKFKLSKAEQDIATLEQS ISRLEGQVLRYKTAAENAEKIEDELKAERRKLQRE 

LRTAQDKIEEMEMTNSHLAKRLEKMKANRTALLAQQ
Transcript ENSMUST00000035078
Sequence
AGCTGCAGCCGCTGCTCGGGCTGCGGCTCGTCCCGGGTCGCGTTCGCTGTGTCGGCCGCGGGGCGAAGGGCGCGCTCAGTGTGACTCCACGACCGGCCGC

GGCGCGAGGAGCCCTTCTTTTTGTCTCCCTGCGGCCCGCGGGGTGGACGGTGCGGGGGGGTGCAGAGTGTGGCCGGCGCTCTCCTCTCCCGGCTCCCGGG

CGGCCGCTCCGGCCCTTCCGGGCGGCGCCGCAGCCTCATCCCGCGCCACACGCAG ATGTGGGAAGACAAATGAAGGGATTTAGAAGCCAAGTAAATGTC

ATTGGGAAGGAGAGCTACCACCACTGAG - UNI3824 - TGCTGAACAGTAAACTCATTTTTCAGAGTTAAAAAATTATTTAAAAAAACAAGATGGGG

ACTCCTGGTTCTGGAAGGAAAAGAACGCCGGTAAAAGATCGATTTTCTGCAGAAGATGAAGCTTTGAGTAACATCGCCAGAGAG - UNI7156 - - U

NI7894 - GCAGAAGCAAGGCTAGCAGCAAAGCGGGCCGCCAGGGCAGAAGCAAGAGACATCCGCATGCGGGAACTGGAACGACAGCAGAGAGAG - U

NI7894 - GGAGTTGAGGATACATTGTCTCTTCGGAGCCTTGGCAGTCACAGG TTGGATGAAAAATCTGACAAACAGTATGCTGAAAACTACACAAGA

 CCTTCATCTCGAAATTCTGCCTCGGCTACAACGCCTCTAAGTGGGAACTCATCCAGACGGGGTAGTGGGGACACCAGCAGCTTAATAGACCCAGACACC

TCACTGAGTGAACTGCGG - UNI7132 - GAGTCTTTGTCTGAAGTAGAAGAGAAATACAAGAAAGCCATGGTGTCCAATGCACAACTAGACAATGAG

AAGAACAATCTGATCTACCAGGTGGACACCCTCAAGGATGTCATTGAAGAGCAGGAGGAGCAGATGGCAGAGTTTTATAGAGAGAACGAAGAGAAGTCAA

AG - UNI2501 - GAGTTAGAAAGGCAGAAACACATGTGCAGCGTGCTGCAGCATAAGATGGATGAACTCAAAGAAGGCCTTCGGCAGAGGGACGAGC

TCATCGAG - UNI4552 - AAACATGGCTTAGTTATAATCCCAGACAGCACTCCCAATGGTGATGTCCATCATGAGCCTGTGGTTGGAGCCATTACTG

CTGTGTCTCAGGAAGCTGCTCAGGTCTTGGAGTCAGCAGGAGAAGGGCCACTAG ATGTGAGGCTACGAAAGCTTGCTGGAGAAAAGGACGAGCTCTTGT

CACAG - UNI1814 - ATTAGAAAACTGAAGCTCCAGTTAGAGGAAGAACGGCAGAAGTGTTCCAGGAATGATGGCATGTCCGGGGACCTGGCAGGAC

TGCAGAACGGCTCAGACTTGCAGTTCATCGAGATGCAGA GAGATGCCAATAGACAAATTAGTGAATACAAATTCAAGCTTTCGAAAGCAGAACAAGACA

TAGCTACCTTGGAACAAAGT ATCAGCCGGCTTGAGGGGCAGGTGCTGAGGTACAAAACTGCTGCTGAGAATGCAGAGAAAATTGAAGATGAGCTGAAAG

CAGAAAGGAGGAAGCTACAGCGAGAG CTACGGACGGCACAGGACAAGATAGAGGAGATGGAGATGACCAACAGCCACCTGGCTAAGCGGCTAGAGAAGA

TGAAAGCCAACAGGACAGCCCTTCTAGCCCAGCAGTAGGAGGCGGCCCTTCTACCTGGGTGCTGCTGAGGACCTTGCCGGGAGATGCTGACTCTTTTGTA

CATTGACACAAGCCCCTTCAAGTACTGTTTTGAGTCTTGTCATTAAACAGCCACCTTTGTATTTTATAATTTATGAGAATGAAGCAGGTTTAATCGTTAA

TGGATTTGGATTTTGTTTGTAGTTCACTTCTACAGTGAGAACTAGTCTGTGCTGTCTTTATTTTCAACATTCTAGAATCACGTTTTCTCACCATCTTCTT

CCTGCCGCCTCGCTGACAGAGGCACTGGGTGGCCTTGCTGTGGGTTCTGGAGGATGGCCATTCTGAGCACTGAGACACTTGCTGGAGACCTCAAAAACCC

AAGTGCCTTCTCCAAAGTGTGATGCAGGCTTCAGAGACCAATGGCCAAGGTTCCTCCTCTTCTTACCAGAGTGTTTACATTTCAGTGAGGATGTGTTCAG

CAGTGGGGAGTCTGTTTCACTCAAATTTATGTTTGGAGGAAAAACCTTTTTTTTTTTTTGAGGGTAAGATATTTAAATTATATAAAAGTTTTAGAAAACA

ATATGGGGAGTGTATATTAAACTTTGCTACATGGGGCAGAGCAAGTCCAAGCCTGTACTCCAAAGACTAGGCTCCTCAGTCTTCACACCCACTGTGCTGT

TCCGTGCGTTTTCATCTGCTGCTTACCTGTGAATGAAGCCTCAGACAAGCTCAAGGGAGGAGGGAGGGACAGTGCAGGCAGGCAGGGAATCCGCCTGAAT

CTACCTACTAAAACACACCTTTCTGCCATCCACGATTGGCTGAGGGCAGTCGATGTTAAAGAAGCCTTTAGGACAAGTCATGGCTACCATGTACAGTCTT

GCTCTTCTTTTCTCAAGATGAGATACTCTGGGATACAGAACTTTCTTCTAGTTTTTTGAGAGAAAGGATCGATGTAGCCCGGCTGGCCTCCACCTCACAA

TCATCCTCATTGGGCCTCTTTGAGTGCTGGGATTCCAGGCAGGTACTTTCATACCTGGTTCCAGAATATAAAGTCCTTAAGAACTTTCATCTTTAAAGAG

CCCAGTTCAAGATACCCCTGCCCCTGCTGTAACCACTTTATAGGGTTTGTGATTCTCATTTGTCAGAATCAAGGTGGTTTCATGGGAATGATTACTATAG

CTCAAAGTGTTTACAGAAACTATATTGAGGAAAAAATCTAATGAATCAAAGCCTCTTAATAAATCTAGCCTTGGAACTAGATAATAAAATTAACTCAAAA

GTG
Translation
  - UNI3824 - MGTPGSGRKRTPVKDRFSAEDEALSNIARE - UNI7156 - - UNI7894 - AEARLAAKRAARAEARDIRMRELERQQRE -

 UNI7894 - GVEDTLSLRSLGSHR LDEKSDKQYAENYTR PSSRNSASATTPLSGNSSRRGSGDTSSLIDPDTSLSELR - UNI7132 - ESLSE

VEEKYKKAMVSNAQLDNEKNNLIYQVDTLKDVIEEQEEQMAEFYRENEEKSK - UNI2501 - ELERQKHMCSVLQHKMDELKEGLRQRDELIE - U

NI4552 - KHGLVIIPDSTPNGDVHHEPVVGAITAVSQEAAQVLESAGEGPLD DVRLRKLAGEKDELLSQ - UNI1814 - IRKLKLQLEEERQKC

SRNDGMSGDLAGLQNGSDLQFIEMQR RDANRQISEYKFKLSKAEQDIATLEQS ISRLEGQVLRYKTAAENAEKIEDELKAERRKLQRE LRTAQDKIE

EMEMTNSHLAKRLEKMKANRTALLAQQ
Transcript ENSMUST00000098340
Sequence
AGCTGCAGCCGCTGCTCGGGCTGCGGCTCGTCCCGGGTCGCGTTCGCTGTGTCGGCCGCGGGGCGAAGGGCGCGCTCAGTGTGACTCCACGACCGGCCGC

GGCGCGAGGAGCCCTTCTTTTTGTCTCCCTGCGGCCCGCGGGGTGGACGGTGCGGGGGGGTGCAGAGTGTGGCCGGCGCTCTCCTCTCCCGGCTCCCGGG

CGGCCGCTCCGGCCCTTCCGGGCGGCGCCGCAGCCTCATCCCGCGCCACACGCAG ATGTGGGAAGACAAATGAAGGGATTTAGAAGCCAAGTAAATGTC

ATTGGGAAGGAGAGCTACCACCACTGAG - UNI3824 - TGCTGAACAGTAAACTCATTTTTCAGAGTTAAAAAATTATTTAAAAAAACAAGATGGGG

ACTCCTGGTTCTGGAAGGAAAAGAACGCCGGTAAAAGATCGATTTTCTGCAGAAGATGAAGCTTTGAGTAACATCGCCAGAGAG - UNI7156 - - U

NI7894 - GCAGAAGCAAGGCTAGCAGCAAAGCGGGCCGCCAGGGCAGAAGCAAGAGACATCCGCATGCGGGAACTGGAACGACAGCAGAGAGAG - U

NI7894 - TTGGATGAAAAATCTGACAAACAGTATGCTGAAAACTACACAAGA CCTTCATCTCGAAATTCTGCCTCGGCTACAACGCCTCTAAGTGGG

AACTCATCCAGACGGGGTAGTGGGGACACCAGCAGCTTAATAGACCCAGACACCTCACTGAGTGAACTGCGG - UNI7132 - GAGTCTTTGTCTGAA

GTAGAAGAGAAATACAAGAAAGCCATGGTGTCCAATGCACAACTAGACAATGAGAAGAACAATCTGATCTACCAGGTGGACACCCTCAAGGATGTCATTG

AAGAGCAGGAGGAGCAGATGGCAGAGTTTTATAGAGAGAACGAAGAGAAGTCAAAG - UNI2501 - GAGTTAGAAAGGCAGAAACACATGTGCAGCG

TGCTGCAGCATAAGATGGATGAACTCAAAGAAGGCCTTCGGCAGAGGGACGAGCTCATCGAG - UNI4552 - AAACATGGCTTAGTTATAATCCCAG

ACAGCACTCCCAATGGTGATGTCCATCATGAGCCTGTGGTTGGAGCCATTACTGCTGTGTCTCAGGAAGCTGCTCAGGTCTTGGAGTCAGCAGGAGAAGG

GCCACTAG ATGTGAGGCTACGAAAGCTTGCTGGAGAAAAGGACGAGCTCTTGTCACAG - UNI1814 - ATTAGAAAACTGAAGCTCCAGTTAGAGG

AAGAACGGCAGAAGTGTTCCAGGAATGATGGCATGTCCGGGGACCTGGCAGGACTGCAGAACGGCTCAGACTTGCAGTTCATCGAGATGCAGA GAGATG

CCAATAGACAAATTAGTGAATACAAATTCAAGCTTTCGAAAGCAGAACAAGACATAGCTACCTTGGAACAAAGT ATCAGCCGGCTTGAGGGGCAGGTGC

TGAGGTACAAAACTGCTGCTGAGAATGCAGAGAAAATTGAAGATGAGCTGAAAGCAGAAAGGAGGAAGCTACAGCGAGAG CTACGGACGGCACAGGACA

AGATAGAGGAGATGGAGATGACCAACAGCCACCTGGCTAAGCGGCTAGAGAAGATGAAAGCCAACAGGACAGCCCTTCTAGCCCAGCAGTAGGAGGCGGC

CCTTCTACCTGGGTGCTGCTGAGGACCTTGCCGGGAGATGCTGACTCTTTTGTACATTGACACAAGCCCCTTCAAGTACTGTTTTGAGTCTTGTCATTAA

ACAGCCACCTTTGTATTTTATAATTTATGAGAATGAAGCAGGTTTAATCGTTAATGGATTTGGATTTTGTTTGTAGTTCACTTCTACAGTGAGAACTAGT

CTGTGCTGTCTTTATTTTCAACATTCTAGAATCACGTTTTCTCACCATCTTCTTCCTGCCGCCTCGCTGACAGAGGCACTGGGTGGCCTTGCTGTGGGTT

CTGGAGGATGGCCATTCTGAGCACTGAGACACTTGCTGGAGACCTCAAAAACCCAAGTGCCTTCTCCAAAGTGTGATGCAGGCTTCAGAGACCAATGGCC

AAGGTTCCTCCTCTTCTTACCAGAGTGTTTACATTTCAGTGAGGATGTGTTCAGCAGTGGGGAGTCTGTTTCACTCAAATTTATGTTTGGAGGAAAAACC

TTTTTTTTTTTTTGAGGGTAAGATATTTAAATTATATAAAAGTTTTAGAAAACAATATGGGGAGTGTATATTAAACTTTGCTACATGGGGCAGAGCAAGT

CCAAGCCTGTACTCCAAAGACTAGGCTCCTCAGTCTTCACACCCACTGTGCTGTTCCGTGCGTTTTCATCTGCTGCTTACCTGTGAATGAAGCCTCAGAC

AAGCTCAAGGGAGGAGGGAGGGACAGTGCAGGCAGGCAGGGAATCCGCCTGAATCTACCTACTAAAACACACCTTTCTGCCATCCACGATTGGCTGAGGG

CAGTCGATGTTAAAGAAGCCTTTAGGACAAGTCATGGCTACCATGTACAGTCTTGCTCTTCTTTTCTCAAGATGAGATACTCTGGGATACAGAACTTTCT

TCTAGTTTTTTGAGAGAAAGGATCGATGTAGCCCGGCTGGCCTCCACCTCACAATCATCCTCATTGGGCCTCTTTGAGTGCTGGGATTCCAGGCAGGTAC

TTTCATACCTGGTTCCAGAATATAAAGTCCTTAAGAACTTTCATCTTTAAAGAGCCCAGTTCAAGATACCCCTGCCCCTGCTGTAACCACTTTATAGGGT

TTGTGATTCTCATTTGTCAGAATCAAGGTGGTTTCATGGGAATGATTACTATAGCTCAAAGTGTTTACAGAAACTATATTGAGGAAAAAATCTAATGAAT

CAAAGCCTCTTAATAAATCTAGCCTTGGAACTAGATAATAAAATTAACTCAAAAGTG
Translation
  - UNI3824 - MGTPGSGRKRTPVKDRFSAEDEALSNIARE - UNI7156 - - UNI7894 - AEARLAAKRAARAEARDIRMRELERQQRE -

 UNI7894 - LDEKSDKQYAENYTR PSSRNSASATTPLSGNSSRRGSGDTSSLIDPDTSLSELR - UNI7132 - ESLSEVEEKYKKAMVSNAQLD

NEKNNLIYQVDTLKDVIEEQEEQMAEFYRENEEKSK - UNI2501 - ELERQKHMCSVLQHKMDELKEGLRQRDELIE - UNI4552 - KHGLVII

PDSTPNGDVHHEPVVGAITAVSQEAAQVLESAGEGPLD DVRLRKLAGEKDELLSQ - UNI1814 - IRKLKLQLEEERQKCSRNDGMSGDLAGLQNG

SDLQFIEMQR RDANRQISEYKFKLSKAEQDIATLEQS ISRLEGQVLRYKTAAENAEKIEDELKAERRKLQRE LRTAQDKIEEMEMTNSHLAKRLEKM

KANRTALLAQQ

For any suggestions or comments, please send an email to unitrap@crg.es