Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032511 (Scn5a)
Chromosomal location
Chr 9: 119392528 - 119488134 (-)
Description
sodium channel, voltage-gated, type V, alpha Gene [Source:MGI (curated);Acc:Scn5a-001]
RefSeq_peptide
NP_067519.2 
UniGene
Mm.103584 
MGI
MGI:98251 
Uniprot/SPTREMBL
Q3UH91 Q6EWG4 Q8C3I3 Q6EWG3 Q9JJV9 
Human Ortholog
ENSG00000183873 (SCN5A)
Omim 108770 - ATRIAL STANDSTILL  113900 - PROGRESSIVE FAMILIAL HEART BLOCK, TYPE IA  272120 - SUDDEN INFANT DEATH SYNDROME  601144 - BRUGADA SYNDROME 1  601154 - CARDIOMYOPATHY, DILATED, 1E  603829 - VENTRICULAR FIBRILLATION, PAROXYSMAL FAMILIAL  608567 - SICK SINUS SYNDROME 1, AUTOSOMAL RECESSIVE  
UniTrap UNI23176
Vector Insertion
Chr 9: 119410914 - 119421258
Public Clones not available
Private Clones OST273841 (lexicon)
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000065196
Sequence
GGAGCCCGAGCGGAGCGGCGGAGCCGAGACGGCGGCGGCGCCCGTGGGATGTGGGGATCGCGCCCCCGGGGCCGCTGAGCCTGCGCCCGCTGCCCCAAGC

CCTACGCCGAACCGAGCCCGCGCCGCGCTGCAGCCGCCCACCCCTAGGCGCGGGCCGGGGACTAGCAG CTTCCTTCCAGGCAGCCTGAGGAGAGCCTGT

GCCCCCAGAAGCAGGATGAGAAGATGGCAAACTTCCTGTTACCTCGGGGCACCAGCAGCTTCCGTAGGTTCACCCGGGAGTCACTGGCGGCCATCGAGAA

GCGCATGGCTGAAAAACAAGCCCGTGGTTCGGCCACCTCACAGGAGAGCCGTGAGGGCCTGCCAGAGGAGGAGGCTCCCCGGCCCCAGCTGGACCTACAG

GCCTCCAAAAAGCTGCCAGATCTCTATGGCAACCCACCCCGAGAGCTCATTGGGGAGCCCCTGGAAGACCTGGACCCTTTCTATAGTACCCAGAAG ACC

TTCATCGTGCTGAATAAGGGCAAAACCATCTTCCGGTTCAGTGCCACCAATGCCTTGTACGTCCTCAGCCCCTTCCACCCGGTGCGCAGAGCGGCTGTGA

AGATTTTGGTACATTCA CTCTTCAGCATGCTCATCATGTGCACCATCCTAACCAACTGTGTGTTCATGGCACAACACGACCCTCCGCCTTGGACCAAAT

ATGTTGA GTACACCTTCACCGCCATCTACACCTTTGAGTCTCTGGTCAAGATTCTAGCTCGAGGCTTCTGCCTGCATGCGTTCACCTTCCTCCGGGACC

CGTGGAACTGGCTAGACTTCAGTGTGATCGTCATGGC GTATGTATCAGAGAATATAAAGCTAGGCAATTTGTCGGCTCTTCGAACTTTCAGAGTCCTGA

GAGCTCTGAAAACGATTTCAGTTATTCCAG GCCTGAAGACAATCGTGGGAGCCCTAATCCAGTCTGTGAAGAAGCTAGCCGATGTGATGGTCCTTACTG

TCTTCTGCCTCAGTGTCTTTGCCCTCATTGGCCTGCAGCTCTTCATGGGCAACCTGAGGCACAAGTGCGTGCGTAACTTTACTGAGCTCAATGGCACCAA

TGGTTCCGTGGAGGCCGATGGCATAGTCTGGAACTCTCTGGACGTCTACCTCAATGACCCAG CCAATTACCTACTCAAGAATGGCACCACGGATGTGTT

GCTGTGTGGGAACAGCTCTGATGCCGG GACATGTCCTGAAGGCTACCGGTGCCTGAAGGCAGGTGAGAACCCTGACCACGGTTACACCAGCTTCGACTC

CTTCGCCTGGGCTTTCCTTGCGCTCTTCCGCCTGATGACACAGGACTGCTGGGAACGTCTATACCAGCAG ACCCTGAGGTCCGCAGGAAAGATCTACAT

GATCTTCTTCATGCTTGTCATATTCCTGGGCTCCTTCTACCTTGTGAACTTGATCCTGGCTGTGGTGGCCATGGCTTACGAGGAGCAAAACCAAGCCACC

ATCGCCGAGACGGAAGAGAAGGAGAAGCGTTTCCAGGAGGCCATGGAGATGCTCAAGAAGGAACACGAG GCTCTCACCATCAGGGGCGTGGATACTGTG

TCCCGTAGCTCTCTGGAGATGTCTCCTTTGGCCCCAGTAACCAACCATGAGAGAAGGAGCAAGAGGAGGAAACGACTGTCTTCAGGGACAGAGGATGGCG

GAGATGACAGGCTCCCCAAGTCGGACTCAGAAGACGGTCCCAGAGCATTG AATCAGCTCAGCCTCACCCATGGGCTCAGCCGGACATCCATGAGGCCCC

GCTCCAGCCGAGGGAGCATTTTCACATTCCGGCGACGGGACCAAGGCTCCGAGGCAGATTTTGCAGATGACGAGAACAGTACAGCAGGAGAGAGCGAGAG

CCACCGCACATCGCTGCTGGTGCCCTGGCCCCTGCGCCGTCCCAGCACCCAAGGGCAGCCCGGCTTTGGAACCTCAGCTCCTGGTCATGTCCTCAATGGC

AAAAGAAACAGCACCGTGGACTGCAATGGGGTGGTTTCCTTGCTGGGGGCAGGGGACGCAGAGGCCACCTCTCCAGGGAGCCACCTTCTCCGCCCTATAG

TGCTGGACAGACCCCCAGACACG ACCACGCCGTCAGAGGAGCCGGGTGGGCCCCAGATGCTGACACCGCAGGCTCCATGTGCAGATGGCTTTGAGGAGC

CCGGGGCACGGCAACGGGCACTCAGCGCCGTCAGTGTCCTCACCAGCGCTCTGGAAG AGTTGGAGGAGTCCCACCGTAAGTGTCCACCATGCTGGAATC

GCTTTGCCCAGCATTACCTCATCTGGGAGTGCTGCCCACTCTGGATGTCCATCAAGCAGAAGGTGAAGTTCGTGGTCATGGACCCGTTTGCTGACCTCAC

CATCACCATGTGCATCGTGCTCAACACGCTCTTCATGGCTCTGGAGCACTACAACATGACAGCCGAGTTTGAGGAGATGCTGCAGGTCGGAAACTTG GT

CTTCACGGGAATCTTCACGGCAGAGATGACCTTCAAGATCATCGCCCTTGACCCATACTACTACTTCCAGCAGGGCTGGAATATCTTCGACAGCATCATC

GTCATCCTCAGCCTCATGGAGCTGGGCCTGTCTCGCATGGGCAACCTGTCTGTGCTGCGTTCCTTCCGTCTG CTGCGGGTCTTCAAGCTGGCCAAATCA

TGGCCCACCCTGAACACACTCATCAAGATCATCGGGAACTCTGTTGGTGCCCTGGGGAACCTGACCCTGGTGCTGGCCATCATCGTCTTCATCTTCGCCG

TGGTGGGTATGCAGCTCTTCGGCAAGAACTACTCAGAGCTGAGGCACCGAATCAGCGACTCTGGCCTGCTGCCCCGCTGGCACATGATGGACTTCTTCCA

CGCCTTCCTCATCATCTTCCGCATCCTCTGTGGAGAGTGGATCGAGACCATGTGGGACTGCATGGAGGTGTCTGGGCAGTCGCTGTGCTTGCTGGTCTTC

CTGCTGGTCATGGTCATTGGCAACCTTGTG GTCCTGAATCTCTTCTTGGCCTTGCTGCTCAGCTCCTTCAGCGCAGACAACCTCACAGCCCCTGACGAG

GATGGGGAGATGAACAACCTCCAGCTGGCCCTGGCTCGCATCCAAAGGGGCCTTCGCTTTGTCAAGCGGACCACCTGGGACTTCTGCTGCGGGCTCCTGC

GGCGGCGACCTAAGAAGCCCGCGGCTCTTGCCACCCACAGCCAGCTGCCCAGCTGTATCGCCGCTCCCAGGTCCCCACCACCCCCAGAGGTGGAGAAGGC

GCCCCCAGCCCGCAAGGAAACACGGTTCGAGGAAGACAAGCGGCCGGGCCAGGGCACCCCTGGGGATACCGAGCCTGTGTGTGTTCCCATCGCAGTGGCT

GAGTCAGACACTGATGACCAGGAAGAGGATGAGGAGAACAGCCTTGGCACGGAGGAGGAAGAGTCCAGCAAACAG CAGGAATCCCAAGTTGTGTCTGGT

GGCCACGAGCCCCCCCAGGAGCCCAGGGCCTGGAGCCAGGTGTCAGAGACCACATCCTCTGAAGCCGAGGCCAGTACGTCTCAGGCAGACTGGCAGCAAG

AGCGGGAAGCGGAGCCCCGGGCCCCGGGGTGCGGTGAG ACTCCCGAGGACAGTTACTCCGAGGGTAGCACCGCTGACATGACCAACACCGCAGACCTCC

TGGAGCAAATCCCAGACCTCGGGGAGGACGTCAAGGACCCAGAGGACTGCTTCACTGAAG GCTGCGTCCGACGTTGTCCTTGCTGCATGGTGGACACGA

CGCAGGCCCCAGGGAAGGTCTGGTGGAGACTGCGCAAGACCTGCTACCGCATAGTGGAGCACAGCTGGTTCGAGACTTTCATCATCTTCATGATCCTGCT

CAGCAGCGGAGCGCTG - UNI23176 - GCCTTCGAGGACATCTACCTGGAGGAGCGGAAGACCATCAAGGTTCTGCTGGAGTACGCCGACAAGATGT

TCACCTATGTCTTTGTGTTGGAGATGCTGCTCAAGTGGGTGGCCTACGGCTTCAAGAAGTACTTCACCAACGCCTGGTGCTGGCTGGACTTCCTAATTGT

GGAC GTCTCACTGGTCAGCCTCGTGGCCAACACCTTAGGCTTTGCCGAGATGGGTCCCATCAAGTCCCTGAGGACACTGCGTGCACTTCGACCCCTGAG

GGCTTTGTCACGATTCGAGGGCATGAGG GTGGTGGTCAACGCGCTGGTGGGCGCCATCCCCTCCATCATGAATGTCCTCCTCGTCTGCCTCATCTTCTG

GCTCATCTTCAGCATCATGGGCGTGAACCTCTTCGCCGGGAAGTTCGGTAGGTGCATCAACCAGACCGAAGGGGACCTGCCTCTGAACTACACCATTGTG

AACAACAAGAGCGAGTGTGAGTCCTTCAACGTGACTGGAGAGTTGTACTGGACCAAGGTGAAAGTCAACTTTGACAACGTGGGGGCTGGGTACCTGGCCC

TGCTGCAGGTG GCGACATTTAAAGGCTGGATGGACATCATGTATGCGGCTGTGGACTCCAGAGGG TATGAAGAGCAGCCGCAGTGGGAGGACAACCTC

TACATGTACATCTACTTCGTCGTCTTCATCATCTTCGGCTCCTTCTTCACCCTCAACCTGTTTATTGGTGTCATCATTGATAACTTCAACCAGCAGAAGA

AAAAG TTAGGGGGCCAGGACATCTTCATGACGGAGGAGCAGAAGAAGTACTACAATGCCATGAAGAAGCTGGGCTCCAAGAAACCCCAGAAGCCCATCC

CACGGCCTCTG AACAAGTACCAGGGTTTCATATTCGACATTGTGACCAAGCAGGCCTTCGATGTTACCATCATGTTCCTCATCTGTTTAAACATGGTGA

CCATGATGGTAGAGACAGATGATCAGAGCCCTGAAAAAGTCAACATCTTGGCCAAGATCAACCTGCTCTTCGTGGCCATCTTCACAGGAGAGTGTATTGT

CAAGATGGCTGCCCTGCGCCACTATTACTTCACCAACAGCTGGAACATCTTCGATTTCGTGGTTGTCATCCTCTCCATCGTTG GCACTGTCCTCTCCGA

CATCATCCAGAAGTACTTCTTCTCCCCAACGCTCTTCCGTGTCATCCGTCTGGCCAGGATCGGCCGCATCCTCAGGCTGATCCGAGGAGCCAAGGGGATT

CGCACGTTGCTCTTCGCCCTCATGATGTCCCTGCCCGCCCTCTTCAACATCGGCCTCCTCCTCTTCCTCGTCATGTTCATCTACTCCATCTTCGGCATGG

CCAACTTTGCCTACGTCAAGTGGGAGGCTGGCATCGACGACATGTTCAACTTCCAGACCTTTGCCAACAGCATGCTGTGCCTTTTCCAGATCACCACGTC

GGCTGGCTGGGATGGCCTCCTCAGCCCCATCCTCAACACAGGACCCCCCTACTGTGACCCCAACCTGCCCAACAGCAATGGCTCCAGGGGGAACTGTGGG

AGCCCAGCAGTGGGCATCCTCTTCTTCACCACCTACATCATCATCTCCTTCCTCATCGTGGTCAACATGTACATTGCCATCATCCTGGAGAACTTCAGTG

TGGCCACAGAAGAGAGCACAGAGCCCCTGAGCGAGGATGACTTCGACATGTTCTATGAGATCTGGGAGAAGTTCGACCCGGAGGCCACCCAGTTCATTGA

GTATTTGGCCCTGTCCGACTTTGCCGATGCCCTGTCTGAGCCACTCCGCATCGCCAAGCCCAACCAGATAAGCCTCATCAATATGGACCTGCCCATGGTG

AGCGGGGACCGCATCCACTGTATGGACATCCTGTTCGCCTTCACCAAGAGGGTGCTCGGGGAGTCTGGGGAGATGGATGCCCTGAAGATCCAGATGGAGG

AGAAATTCATGGCGGCCAATCCTTCCAAGATCTCCTATGAGCCCATCACCACCACCCTGCGGCGAAAACATGAGGAGGTGTCGGCCACGGTCATCCAGCG

GGCCTTCCGGAGGCACCTCCTGCAGCGCTCGGTGAAGCATGCTTCCTTCCTCTTCCGCCAGCAAGCGGGCAGCAGTGGCCTCTCTGATGAGGATGCCCCC

GAGCGAGAGGGACTCATTGCCTACATGATGAATGAGAACTTCTCCCGGCGCAGCGGTCCCCTCTCCAGCTCTTCCATCTCCTCCACGTCCTTCCCACCGT

CCTATGACAGCGTCACGAGGGCCACCAGTGATAACCTCCCAGTGCGTGCGTCGGACTACAGCCGCAGCGAAGATCTTGCAGACTTCCCTCCATCTCCAGA

TAGGGACCGAGAGTCTATAGTGTGAACCTGGCCACCCGTCCGGCCAGGACGTGCCCTGTTGTATCCTGACAAACCTTAAGCAGTTGAAACCAGTGTCGGC

TAAGGCCTTCCTAGCTCTGGAGGTGACAGGGGAACCTCCAGGTGGAGGAACCACACGGCAGAGTTCTGTGTGTCTGTGTTGAAGCTAGAGGCGGCTAGAG

CAACCCTGGCTGGTAGAGGCCTGGCACACCCTAGTAGCCGGGTCTGGCCAGGCAGCGCCGCATGGCTCTGAACAGCAACTCTGTCCCCCTCTGAGGTGAA

ACGGGAAACACACTGTACATGTTGTGAACAAGCTTTCATAGGTTTATTATATTTGATATTTTTTTACTCGAGCAAAGAACATCTTTTTCCATGAACATCT

GCAGCAGTTCACACGGCCTCTTCCTAACCCTGAGCAGGTGTCAATGGAGAACTCTGCTCTCAGAGCTAACGTGGAATCTTCGCACCCAAGGGGAGGGTTG

TGGTTCCTGTCACCTGGGCTGAGGAGCCAGGAAGGCCTAAGCACTTCACTCACACACGCGAGTGGGCGAGTGCGTGTGCCTGTGCACACTTCACACACTG

GGGCGGGACATAGGCCGCAGGGACCCAGGGTCGCCTCAGGCAAATGTGGTTGGTCGGTGGCTCCAAAGGCGAGAGGTTTTTCTTCCTGGCCCCCCAGTGT

GGGTTTCTTCCTGTGAACTCACTCTGTGCCCCTGTTGTCCACAGGATTCCAGTCTCCTGTTCTCAGTCAGGCTTCGCTTGAGGTCAGTGCTATAAAAATT

GAAAGCTTCCAGAGAGCTGCCCTGGTCTCCCTTCCTCTCCTGTAAGAGTATTAATGTTGGGGCCCAAGGGCTCGAGGAAGGCAGCCTCGCTCACAGCCAG

GCACGTAGCTTGCTTCTGAGATGTGGCAGGCCCTGTCCCAAGGCCAAGGGAGGAGAAGGCTGTCCCACGTGGGCCGCTGAACTGTGTCCAGCTGTGGCAG

CAAAGGGAGCGGTCTCCATTTCCCAGGCTCCTCTGGGGTCTCTGCCTCTGGCCGTGTGTCAAGGAGATGCCCACTGGGGCTCCAACCGTCTTCAGACACT

GTGGAAGTGGGAGGGTAGCCTGGCCCTGTCTAGGAGAAAGGCCCTGCGTGGTCAGGCCTGGTTCTGTGACCTGGAAGGTGACAAGCCATCCATCCCCCAT

GGGAGAGGAGACAGTGTGGCATCTGGGCCCAGCCCAGGGTCTGACTATCCTAGGCGTCTTCTGAGAAGGCTTTTTCAGGGAAAACAAACAAACCGATTTT

ATAAGTCCAATCATCCCCGTGACCTCCTCAGCTGCTGACAATCCTATTTAGCATATGCAAATCTTTTATTGTAGAGGACCAGACCATCGCTGCTGAAGGG

ACAGGCTGGTGGAGCCTGAGCAGGCAGGGGCTTGGCTGCCCAAGTCTAGCTCTCCAGCAGAGCCACCCTCGGCTGGGGGCACCCACCTCACAGGCCACCT

CAGTGGCGCCTGCCCACTGCGGGCTGGCTGCTCCTACCTACCTCGCCGAGCTGTCGGAGGGCTGGACGCTCCTGGCAGTGCTGAAGGAGGGGGCACTGCG

GGCAAGTCAAGTATTATGTTTCTTCTTGTCACCTCAGTTCCCTTGGTGGCAGCTGGCTCCCGCCCCACCTGCCCCTGGCGGCTTATCCAATGTCCCCACG

GAGTCCGGTGTGGGGGGTTTGGTTCTAACTGTCCTGGTGATGCCTCTCTGAGTGGAAATCTTATTTTTGTAGATCTGTACTTTGCTCTCGAGGCTTGGAG

AGATGTGTGTCCCTCCCTGGCACTCACTTCAGGCCGCATGGGCAGGAATGTGGCCTGGGGCTGGCAGGGTTGGCAGGGCTGCCATCCCAGCTGGCCGGAA

AGAGGCTGTGGTTTCGAATATGCAGATGGCCTTGGAGCCTTAAGACAGGTGCCGGGCTGGCTGCAGACAGGGTGGCTGAGGGGAGGGGCAATCGAGTCCC

GAGTCCTTGGCTTAGCATGGCCTCCTTTTCTAGAACTGCACAGAGGGGAGGAGAGAGTAGCCGGTAGACGGAAGGAGGGAGGGGCATGCGTACATGTCAG

GTGTTGTTTGAGGTAAATGAGCACTTCTCACTAAGCTTCGTGTATAAATGGAATACATTATTTTTCAAACAAACGAATAAATGGCTTACATG
Translation
 MANFLLPRGTSSFRRFTRESLAAIEKRMAEKQARGSATSQESREGLPEEEAPRPQLDLQASKKLPDLYGNPPRELIGEPLEDLDPFYSTQK TFIVLNK

GKTIFRFSATNALYVLSPFHPVRRAAVKILVHS LFSMLIMCTILTNCVFMAQHDPPPWTKYVE EYTFTAIYTFESLVKILARGFCLHAFTFLRDPWNW

LDFSVIVMA AYVSENIKLGNLSALRTFRVLRALKTISVIPG GLKTIVGALIQSVKKLADVMVLTVFCLSVFALIGLQLFMGNLRHKCVRNFTELNGTN

GSVEADGIVWNSLDVYLNDPA ANYLLKNGTTDVLLCGNSSDAG GTCPEGYRCLKAGENPDHGYTSFDSFAWAFLALFRLMTQDCWERLYQQ TLRSAG

KIYMIFFMLVIFLGSFYLVNLILAVVAMAYEEQNQATIAETEEKEKRFQEAMEMLKKEHE ALTIRGVDTVSRSSLEMSPLAPVTNHERRSKRRKRLSSG

TEDGGDDRLPKSDSEDGPRAL NQLSLTHGLSRTSMRPRSSRGSIFTFRRRDQGSEADFADDENSTAGESESHRTSLLVPWPLRRPSTQGQPGFGTSAPG

HVLNGKRNSTVDCNGVVSLLGAGDAEATSPGSHLLRPIVLDRPPDT TTPSEEPGGPQMLTPQAPCADGFEEPGARQRALSAVSVLTSALEE ELEESHR

KCPPCWNRFAQHYLIWECCPLWMSIKQKVKFVVMDPFADLTITMCIVLNTLFMALEHYNMTAEFEEMLQVGNL VFTGIFTAEMTFKIIALDPYYYFQQG

WNIFDSIIVILSLMELGLSRMGNLSVLRSFRL LRVFKLAKSWPTLNTLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKNYSELRHRISDSGLLP

RWHMMDFFHAFLIIFRILCGEWIETMWDCMEVSGQSLCLLVFLLVMVIGNLV VLNLFLALLLSSFSADNLTAPDEDGEMNNLQLALARIQRGLRFVKRT

TWDFCCGLLRRRPKKPAALATHSQLPSCIAAPRSPPPPEVEKAPPARKETRFEEDKRPGQGTPGDTEPVCVPIAVAESDTDDQEEDEENSLGTEEEESSK

Q QESQVVSGGHEPPQEPRAWSQVSETTSSEAEASTSQADWQQEREAEPRAPGCGE TPEDSYSEGSTADMTNTADLLEQIPDLGEDVKDPEDCFTEG G

CVRRCPCCMVDTTQAPGKVWWRLRKTCYRIVEHSWFETFIIFMILLSSGAL - UNI23176 - AFEDIYLEERKTIKVLLEYADKMFTYVFVLEMLLK

WVAYGFKKYFTNAWCWLDFLIVD VSLVSLVANTLGFAEMGPIKSLRTLRALRPLRALSRFEGMR VVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNL

FAGKFGRCINQTEGDLPLNYTIVNNKSECESFNVTGELYWTKVKVNFDNVGAGYLALLQV ATFKGWMDIMYAAVDSRG YEEQPQWEDNLYMYIYFVVF

IIFGSFFTLNLFIGVIIDNFNQQKKK LGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPL NKYQGFIFDIVTKQAFDVTIMFLICLNMVTMMVETDD

QSPEKVNILAKINLLFVAIFTGECIVKMAALRHYYFTNSWNIFDFVVVILSIVG GTVLSDIIQKYFFSPTLFRVIRLARIGRILRLIRGAKGIRTLLFA

LMMSLPALFNIGLLLFLVMFIYSIFGMANFAYVKWEAGIDDMFNFQTFANSMLCLFQITTSAGWDGLLSPILNTGPPYCDPNLPNSNGSRGNCGSPAVGI

LFFTTYIIISFLIVVNMYIAIILENFSVATEESTEPLSEDDFDMFYEIWEKFDPEATQFIEYLALSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIH

CMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSATVIQRAFRRHLLQRSVKHASFLFRQQAGSSGLSDEDAPEREGLI

AYMMNENFSRRSGPLSSSSISSTSFPPSYDSVTRATSDNLPVRASDYSRSEDLADFPPSPDRDRESIV
Transcript ENSMUST00000117911
Sequence
GGAGCCCGAGCGGAGCGGCGGAGCCGAGACGGCGGCGGCGCCCGTGGGATGTGGGGATCGCGCCCCCGGGGCCGCTGAGCCTGCGCCCGCTGCCCCAAGC

CCTACGCCGAACCGAGCCCGCGCCGCGCTGCAGCCGCCCACCCCTAGGCGCGGGCCGGGGACTAGCAG CTTCCTTCCAGGCAGCCTGAGGAGAGCCTGT

GCCCCCAGAAGCAGGATGAGAAGATGGCAAACTTCCTGTTACCTCGGGGCACCAGCAGCTTCCGTAGGTTCACCCGGGAGTCACTGGCGGCCATCGAGAA

GCGCATGGCTGAAAAACAAGCCCGTGGTTCGGCCACCTCACAGGAGAGCCGTGAGGGCCTGCCAGAGGAGGAGGCTCCCCGGCCCCAGCTGGACCTACAG

GCCTCCAAAAAGCTGCCAGATCTCTATGGCAACCCACCCCGAGAGCTCATTGGGGAGCCCCTGGAAGACCTGGACCCTTTCTATAGTACCCAGAAG ACC

TTCATCGTGCTGAATAAGGGCAAAACCATCTTCCGGTTCAGTGCCACCAATGCCTTGTACGTCCTCAGCCCCTTCCACCCGGTGCGCAGAGCGGCTGTGA

AGATTTTGGTACATTC GCTCTTCAGCATGCTCATCATGTGCACCATCCTAACCAACTGTGTGTTCATGGCACAACACGACCCTCCGCCTTGGACCAAAT

ATGTTGA GTACACCTTCACCGCCATCTACACCTTTGAGTCTCTGGTCAAGATTCTAGCTCGAGGCTTCTGCCTGCATGCGTTCACCTTCCTCCGGGACC

CGTGGAACTGGCTAGACTTCAGTGTGATCGTCATGGC GTATGTATCAGAGAATATAAAGCTAGGCAATTTGTCGGCTCTTCGAACTTTCAGAGTCCTGA

GAGCTCTGAAAACGATTTCAGTTATTCCAG GCCTGAAGACAATCGTGGGAGCCCTAATCCAGTCTGTGAAGAAGCTAGCCGATGTGATGGTCCTTACTG

TCTTCTGCCTCAGTGTCTTTGCCCTCATTGGCCTGCAGCTCTTCATGGGCAACCTGAGGCACAAGTGCGTGCGTAACTTTACTGAGCTCAATGGCACCAA

TGGTTCCGTGGAGGCCGATGGCATAGTCTGGAACTCTCTGGACGTCTACCTCAATGACCCAG CCAATTACCTACTCAAGAATGGCACCACGGATGTGTT

GCTGTGTGGGAACAGCTCTGATGCCGG GACATGTCCTGAAGGCTACCGGTGCCTGAAGGCAGGTGAGAACCCTGACCACGGTTACACCAGCTTCGACTC

CTTCGCCTGGGCTTTCCTTGCGCTCTTCCGCCTGATGACACAGGACTGCTGGGAACGTCTATACCAGCAG ACCCTGAGGTCCGCAGGAAAGATCTACAT

GATCTTCTTCATGCTTGTCATATTCCTGGGCTCCTTCTACCTTGTGAACTTGATCCTGGCTGTGGTGGCCATGGCTTACGAGGAGCAAAACCAAGCCACC

ATCGCCGAGACGGAAGAGAAGGAGAAGCGTTTCCAGGAGGCCATGGAGATGCTCAAGAAGGAACACGAG GCTCTCACCATCAGGGGCGTGGATACTGTG

TCCCGTAGCTCTCTGGAGATGTCTCCTTTGGCCCCAGTAACCAACCATGAGAGAAGGAGCAAGAGGAGGAAACGACTGTCTTCAGGGACAGAGGATGGCG

GAGATGACAGGCTCCCCAAGTCGGACTCAGAAGACGGTCCCAGAGCATTG AATCAGCTCAGCCTCACCCATGGGCTCAGCCGGACATCCATGAGGCCCC

GCTCCAGCCGAGGGAGCATTTTCACATTCCGGCGACGGGACCAAGGCTCCGAGGCAGATTTTGCAGATGACGAGAACAGTACAGCAGGAGAGAGCGAGAG

CCACCGCACATCGCTGCTGGTGCCCTGGCCCCTGCGCCGTCCCAGCACCCAAGGGCAGCCCGGCTTTGGAACCTCAGCTCCTGGTCATGTCCTCAATGGC

AAAAGAAACAGCACCGTGGACTGCAATGGGGTGGTTTCCTTGCTGGGGGCAGGGGACGCAGAGGCCACCTCTCCAGGGAGCCACCTTCTCCGCCCTATAG

TGCTGGACAGACCCCCAGACACG ACCACGCCGTCAGAGGAGCCGGGTGGGCCCCAGATGCTGACACCGCAGGCTCCATGTGCAGATGGCTTTGAGGAGC

CCGGGGCACGGCAACGGGCACTCAGCGCCGTCAGTGTCCTCACCAGCGCTCTGGAAG AGTTGGAGGAGTCCCACCGTAAGTGTCCACCATGCTGGAATC

GCTTTGCCCAGCATTACCTCATCTGGGAGTGCTGCCCACTCTGGATGTCCATCAAGCAGAAGGTGAAGTTCGTGGTCATGGACCCGTTTGCTGACCTCAC

CATCACCATGTGCATCGTGCTCAACACGCTCTTCATGGCTCTGGAGCACTACAACATGACAGCCGAGTTTGAGGAGATGCTGCAGGTCGGAAACTTG GT

CTTCACGGGAATCTTCACGGCAGAGATGACCTTCAAGATCATCGCCCTTGACCCATACTACTACTTCCAGCAGGGCTGGAATATCTTCGACAGCATCATC

GTCATCCTCAGCCTCATGGAGCTGGGCCTGTCTCGCATGGGCAACCTGTCTGTGCTGCGTTCCTTCCGTCTG CTGCGGGTCTTCAAGCTGGCCAAATCA

TGGCCCACCCTGAACACACTCATCAAGATCATCGGGAACTCTGTTGGTGCCCTGGGGAACCTGACCCTGGTGCTGGCCATCATCGTCTTCATCTTCGCCG

TGGTGGGTATGCAGCTCTTCGGCAAGAACTACTCAGAGCTGAGGCACCGAATCAGCGACTCTGGCCTGCTGCCCCGCTGGCACATGATGGACTTCTTCCA

CGCCTTCCTCATCATCTTCCGCATCCTCTGTGGAGAGTGGATCGAGACCATGTGGGACTGCATGGAGGTGTCTGGGCAGTCGCTGTGCTTGCTGGTCTTC

CTGCTGGTCATGGTCATTGGCAACCTTGTG GTCCTGAATCTCTTCTTGGCCTTGCTGCTCAGCTCCTTCAGCGCAGACAACCTCACAGCCCCTGACGAG

GATGGGGAGATGAACAACCTCCAGCTGGCCCTGGCTCGCATCCAAAGGGGCCTTCGCTTTGTCAAGCGGACCACCTGGGACTTCTGCTGCGGGCTCCTGC

GGCGGCGACCTAAGAAGCCCGCGGCTCTTGCCACCCACAGCCAGCTGCCCAGCTGTATCGCCGCTCCCAGGTCCCCACCACCCCCAGAGGTGGAGAAGGC

GCCCCCAGCCCGCAAGGAAACACGGTTCGAGGAAGACAAGCGGCCGGGCCAGGGCACCCCTGGGGATACCGAGCCTGTGTGTGTTCCCATCGCAGTGGCT

GAGTCAGACACTGATGACCAGGAAGAGGATGAGGAGAACAGCCTTGGCACGGAGGAGGAAGAGTCCAGCAAACAG CAGGAATCCCAAGTTGTGTCTGGT

GGCCACGAGCCCCCCCAGGAGCCCAGGGCCTGGAGCCAGGTGTCAGAGACCACATCCTCTGAAGCCGAGGCCAGTACGTCTCAGGCAGACTGGCAGCAAG

AGCGGGAAGCGGAGCCCCGGGCCCCGGGGTGCGGTGAG ACTCCCGAGGACAGTTACTCCGAGGGTAGCACCGCTGACATGACCAACACCGCAGACCTCC

TGGAGCAAATCCCAGACCTCGGGGAGGACGTCAAGGACCCAGAGGACTGCTTCACTGAAG GCTGCGTCCGACGTTGTCCTTGCTGCATGGTGGACACGA

CGCAGGCCCCAGGGAAGGTCTGGTGGAGACTGCGCAAGACCTGCTACCGCATAGTGGAGCACAGCTGGTTCGAGACTTTCATCATCTTCATGATCCTGCT

CAGCAGCGGAGCGCTG - UNI23176 - GCCTTCGAGGACATCTACCTGGAGGAGCGGAAGACCATCAAGGTTCTGCTGGAGTACGCCGACAAGATGT

TCACCTATGTCTTTGTGTTGGAGATGCTGCTCAAGTGGGTGGCCTACGGCTTCAAGAAGTACTTCACCAACGCCTGGTGCTGGCTGGACTTCCTAATTGT

GGAC GTCTCACTGGTCAGCCTCGTGGCCAACACCTTAGGCTTTGCCGAGATGGGTCCCATCAAGTCCCTGAGGACACTGCGTGCACTTCGACCCCTGAG

GGCTTTGTCACGATTCGAGGGCATGAGG GTGGTGGTCAACGCGCTGGTGGGCGCCATCCCCTCCATCATGAATGTCCTCCTCGTCTGCCTCATCTTCTG

GCTCATCTTCAGCATCATGGGCGTGAACCTCTTCGCCGGGAAGTTCGGTAGGTGCATCAACCAGACCGAAGGGGACCTGCCTCTGAACTACACCATTGTG

AACAACAAGAGCGAGTGTGAGTCCTTCAACGTGACTGGAGAGTTGTACTGGACCAAGGTGAAAGTCAACTTTGACAACGTGGGGGCTGGGTACCTGGCCC

TGCTGCAGGTG GCGACATTTAAAGGCTGGATGGACATCATGTATGCGGCTGTGGACTCCAGAGGG TATGAAGAGCAGCCGCAGTGGGAGGACAACCTC

TACATGTACATCTACTTCGTCGTCTTCATCATCTTCGGCTCCTTCTTCACCCTCAACCTGTTTATTGGTGTCATCATTGATAACTTCAACCAGCAGAAGA

AAAAG TTAGGGGGCCAGGACATCTTCATGACGGAGGAGCAGAAGAAGTACTACAATGCCATGAAGAAGCTGGGCTCCAAGAAACCCCAGAAGCCCATCC

CACGGCCTCTG AACAAGTACCAGGGTTTCATATTCGACATTGTGACCAAGCAGGCCTTCGATGTTACCATCATGTTCCTCATCTGTTTAAACATGGTGA

CCATGATGGTAGAGACAGATGATCAGAGCCCTGAAAAAGTCAACATCTTGGCCAAGATCAACCTGCTCTTCGTGGCCATCTTCACAGGAGAGTGTATTGT

CAAGATGGCTGCCCTGCGCCACTATTACTTCACCAACAGCTGGAACATCTTCGATTTCGTGGTTGTCATCCTCTCCATCGTTG GCACTGTCCTCTCCGA

CATCATCCAGAAGTACTTCTTCTCCCCAACGCTCTTCCGTGTCATCCGTCTGGCCAGGATCGGCCGCATCCTCAGGCTGATCCGAGGAGCCAAGGGGATT

CGCACGTTGCTCTTCGCCCTCATGATGTCCCTGCCCGCCCTCTTCAACATCGGCCTCCTCCTCTTCCTCGTCATGTTCATCTACTCCATCTTCGGCATGG

CCAACTTTGCCTACGTCAAGTGGGAGGCTGGCATCGACGACATGTTCAACTTCCAGACCTTTGCCAACAGCATGCTGTGCCTTTTCCAGATCACCACGTC

GGCTGGCTGGGATGGCCTCCTCAGCCCCATCCTCAACACAGGACCCCCCTACTGTGACCCCAACCTGCCCAACAGCAATGGCTCCAGGGGGAACTGTGGG

AGCCCAGCAGTGGGCATCCTCTTCTTCACCACCTACATCATCATCTCCTTCCTCATCGTGGTCAACATGTACATTGCCATCATCCTGGAGAACTTCAGTG

TGGCCACAGAAGAGAGCACAGAGCCCCTGAGCGAGGATGACTTCGACATGTTCTATGAGATCTGGGAGAAGTTCGACCCGGAGGCCACCCAGTTCATTGA

GTATTTGGCCCTGTCCGACTTTGCCGATGCCCTGTCTGAGCCACTCCGCATCGCCAAGCCCAACCAGATAAGCCTCATCAATATGGACCTGCCCATGGTG

AGCGGGGACCGCATCCACTGTATGGACATCCTGTTCGCCTTCACCAAGAGGGTGCTCGGGGAGTCTGGGGAGATGGATGCCCTGAAGATCCAGATGGAGG

AGAAATTCATGGCGGCCAATCCTTCCAAGATCTCCTATGAGCCCATCACCACCACCCTGCGGCGAAAACATGAGGAGGTGTCGGCCACGGTCATCCAGCG

GGCCTTCCGGAGGCACCTCCTGCAGCGCTCGGTGAAGCATGCTTCCTTCCTCTTCCGCCAGCAAGCGGGCAGCAGTGGCCTCTCTGATGAGGATGCCCCC

GAGCGAGAGGGACTCATTGCCTACATGATGAATGAGAACTTCTCCCGGCGCAGCGGTCCCCTCTCCAGCTCTTCCATCTCCTCCACGTCCTTCCCACCGT

CCTATGACAGCGTCACGAGGGCCACCAGTGATAACCTCCCAGTGCGTGCGTCGGACTACAGCCGCAGCGAAGATCTTGCAGACTTCCCTCCATCTCCAGA

TAGGGACCGAGAGTCTATAGTGTGAACCTGGCCACCCGTCCGGCCAGGACGTGCCCTGTTGTATCCTGACAAACCTTAAGCAGTTGAAACCAGTGTCGGC

TAAGGCCTTCCTAGCTCTGGAGGTGACAGGGGAACCTCCAGGTGGAGGAACCACACGGCAGAGTTCTGTGTGTCTGTGTTGAAGCTAGAGGCGGCTAGAG

CAACCCTGGCTGGTAGAGGCCTGGCACACCCTAGTAGCCGGGTCTGGCCAGGCAGCGCCGCATGGCTCTGAACAGCAACTCTGTCCCCCTCTGAGGTGAA

ACGGGAAACACACTGTACATGTTGTGAACAAGCTTTCATAGGTTTATTATATTTGATATTTTTTTACTCGAGCAAAGAACATCTTTTTCCATGAACATCT

GCAGCAGTTCACACGGCCTCTTCCTAACCCTGAGCAGGTGTCAATGGAGAACTCTGCTCTCAGAGCTAACGTGGAATCTTCGCACCCAAGGGGAGGGTTG

TGGTTCCTGTCACCTGGGCTGAGGAGCCAGGAAGGCCTAAGCACTTCACTCACACACGCGAGTGGGCGAGTGCGTGTGCCTGTGCACACTTCACACACTG

GGGCGGGACATAGGCCGCAGGGACCCAGGGTCGCCTCAGGCAAATGTGGTTGGTCGGTGGCTCCAAAGGCGAGAGGTTTTTCTTCCTGGCCCCCCAGTGT

GGGTTTCTTCCTGTGAACTCACTCTGTGCCCCTGTTGTCCACAGGATTCCAGTCTCCTGTTCTCAGTCAGGCTTCGCTTGAGGTCAGTGCTATAAAAATT

GAAAGCTTCCAGAGAGCTGCCCTGGTCTCCCTTCCTCTCCTGTAAGAGTATTAATGTTGGGGCCCAAGGGCTCGAGGAAGGCAGCCTCGCTCACAGCCAG

GCACGTAGCTTGCTTCTGAGATGTGGCAGGCCCTGTCCCAAGGCCAAGGGAGGAGAAGGCTGTCCCACGTGGGCCGCTGAACTGTGTCCAGCTGTGGCAG

CAAAGGGAGCGGTCTCCATTTCCCAGGCTCCTCTGGGGTCTCTGCCTCTGGCCGTGTGTCAAGGAGATGCCCACTGGGGCTCCAACCGTCTTCAGACACT

GTGGAAGTGGGAGGGTAGCCTGGCCCTGTCTAGGAGAAAGGCCCTGCGTGGTCAGGCCTGGTTCTGTGACCTGGAAGGTGACAAGCCATCCATCCCCCAT

GGGAGAGGAGACAGTGTGGCATCTGGGCCCAGCCCAGGGTCTGACTATCCTAGGCGTCTTCTGAGAAGGCTTTTTCAGGGAAAACAAACAAACCGATTTT

ATAAGTCCAATCATCCCCGTGACCTCCTCAGCTGCTGACAATCCTATTTAGCATATGCAAATCTTTTATTGTAGAGGACCAGACCATCGCTGCTGAAGGG

ACAGGCTGGTGGAGCCTGAGCAGGCAGGGGCTTGGCTGCCCAAGTCTAGCTCTCCAGCAGAGCCACCCTCGGCTGGGGGCACCCACCTCACAGGCCACCT

CAGTGGCGCCTGCCCACTGCGGGCTGGCTGCTCCTACCTACCTCGCCGAGCTGTCGGAGGGCTGGACGCTCCTGGCAGTGCTGAAGGAGGGGGCACTGCG

GGCAAGTCAAGTATTATGTTTCTTCTTGTCACCTCAGTTCCCTTGGTGGCAGCTGGCTCCCGCCCCACCTGCCCCTGGCGGCTTATCCAATGTCCCCACG

GAGTCCGGTGTGGGGGGTTTGGTTCTAACTGTCCTGGTGATGCCTCTCTGAGTGGAAATCTTATTTTTGTAGATCTGTACTTTGCTCTCGAGGCTTGGAG

AGATGTGTGTCCCTCCCTGGCACTCACTTCAGGCCGCATGGGCAGGAATGTGGCCTGGGGCTGGCAGGGTTGGCAGGGCTGCCATCCCAGCTGGCCGGAA

AGAGGCTGTGGTTTCGAATATGCAGATGGCCTTGGAGCCTTAAGACAGGTGCCGGGCTGGCTGCAGACAGGGTGGCTGAGGGGAGGGGCAATCGAGTCCC

GAGTCCTTGGCTTAGCATGGCCTCCTTTTCTAGAACTGCACAGAGGGGAGGAGAGAGTAGCCGGTAGACGGAAGGAGGGAGGGGCATGCGTACATGTCAG

GTGTTGTTTGAGGTAAATGAGCACTTCTCACTAAGCTTCGTGTATAAATGGAATACATTATTTTTCAAACAAACGAATAAATGGCTTACATGA
Translation
 MANFLLPRGTSSFRRFTRESLAAIEKRMAEKQARGSATSQESREGLPEEEAPRPQLDLQASKKLPDLYGNPPRELIGEPLEDLDPFYSTQK TFIVLNK

GKTIFRFSATNALYVLSPFHPVRRAAVKILVHS SLFSMLIMCTILTNCVFMAQHDPPPWTKYVE EYTFTAIYTFESLVKILARGFCLHAFTFLRDPWN

WLDFSVIVMA AYVSENIKLGNLSALRTFRVLRALKTISVIPG GLKTIVGALIQSVKKLADVMVLTVFCLSVFALIGLQLFMGNLRHKCVRNFTELNGT

NGSVEADGIVWNSLDVYLNDPA ANYLLKNGTTDVLLCGNSSDAG GTCPEGYRCLKAGENPDHGYTSFDSFAWAFLALFRLMTQDCWERLYQQ TLRSA

GKIYMIFFMLVIFLGSFYLVNLILAVVAMAYEEQNQATIAETEEKEKRFQEAMEMLKKEHE ALTIRGVDTVSRSSLEMSPLAPVTNHERRSKRRKRLSS

GTEDGGDDRLPKSDSEDGPRAL NQLSLTHGLSRTSMRPRSSRGSIFTFRRRDQGSEADFADDENSTAGESESHRTSLLVPWPLRRPSTQGQPGFGTSAP

GHVLNGKRNSTVDCNGVVSLLGAGDAEATSPGSHLLRPIVLDRPPDT TTPSEEPGGPQMLTPQAPCADGFEEPGARQRALSAVSVLTSALEE ELEESH

RKCPPCWNRFAQHYLIWECCPLWMSIKQKVKFVVMDPFADLTITMCIVLNTLFMALEHYNMTAEFEEMLQVGNL VFTGIFTAEMTFKIIALDPYYYFQQ

GWNIFDSIIVILSLMELGLSRMGNLSVLRSFRL LRVFKLAKSWPTLNTLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKNYSELRHRISDSGLL

PRWHMMDFFHAFLIIFRILCGEWIETMWDCMEVSGQSLCLLVFLLVMVIGNLV VLNLFLALLLSSFSADNLTAPDEDGEMNNLQLALARIQRGLRFVKR

TTWDFCCGLLRRRPKKPAALATHSQLPSCIAAPRSPPPPEVEKAPPARKETRFEEDKRPGQGTPGDTEPVCVPIAVAESDTDDQEEDEENSLGTEEEESS

KQ QESQVVSGGHEPPQEPRAWSQVSETTSSEAEASTSQADWQQEREAEPRAPGCGE TPEDSYSEGSTADMTNTADLLEQIPDLGEDVKDPEDCFTEG 

GCVRRCPCCMVDTTQAPGKVWWRLRKTCYRIVEHSWFETFIIFMILLSSGAL - UNI23176 - AFEDIYLEERKTIKVLLEYADKMFTYVFVLEMLL

KWVAYGFKKYFTNAWCWLDFLIVD VSLVSLVANTLGFAEMGPIKSLRTLRALRPLRALSRFEGMR VVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVN

LFAGKFGRCINQTEGDLPLNYTIVNNKSECESFNVTGELYWTKVKVNFDNVGAGYLALLQV ATFKGWMDIMYAAVDSRG YEEQPQWEDNLYMYIYFVV

FIIFGSFFTLNLFIGVIIDNFNQQKKK LGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPL NKYQGFIFDIVTKQAFDVTIMFLICLNMVTMMVETD

DQSPEKVNILAKINLLFVAIFTGECIVKMAALRHYYFTNSWNIFDFVVVILSIVG GTVLSDIIQKYFFSPTLFRVIRLARIGRILRLIRGAKGIRTLLF

ALMMSLPALFNIGLLLFLVMFIYSIFGMANFAYVKWEAGIDDMFNFQTFANSMLCLFQITTSAGWDGLLSPILNTGPPYCDPNLPNSNGSRGNCGSPAVG

ILFFTTYIIISFLIVVNMYIAIILENFSVATEESTEPLSEDDFDMFYEIWEKFDPEATQFIEYLALSDFADALSEPLRIAKPNQISLINMDLPMVSGDRI

HCMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSATVIQRAFRRHLLQRSVKHASFLFRQQAGSSGLSDEDAPEREGL

IAYMMNENFSRRSGPLSSSSISSTSFPPSYDSVTRATSDNLPVRASDYSRSEDLADFPPSPDRDRESIV
Transcript ENSMUST00000120420
Sequence
GGAGCCCGAGCGGAGCGGCGGAGCCGAGACGGCGGCGGCGCCCGTGGGATGTGGGGATCGCGCCCCCGGGGCCGCTGAGCCTGCGCCCGCTGCCCCAAGC

CCTACGCCGAACCGAGCCCGCGCCGCGCTGCAGCCGCCCACCCCTAGGCGCGGGCCGGGGACTAGCAG CTTCCTTCCAGGCAGCCTGAGGAGAGCCTGT

GCCCCCAGAAGCAGGATGAGAAGATGGCAAACTTCCTGTTACCTCGGGGCACCAGCAGCTTCCGTAGGTTCACCCGGGAGTCACTGGCGGCCATCGAGAA

GCGCATGGCTGAAAAACAAGCCCGTGGTTCGGCCACCTCACAGGAGAGCCGTGAGGGCCTGCCAGAGGAGGAGGCTCCCCGGCCCCAGCTGGACCTACAG

GCCTCCAAAAAGCTGCCAGATCTCTATGGCAACCCACCCCGAGAGCTCATTGGGGAGCCCCTGGAAGACCTGGACCCTTTCTATAGTACCCAGAAG ACC

TTCATCGTGCTGAATAAGGGCAAAACCATCTTCCGGTTCAGTGCCACCAATGCCTTGTACGTCCTCAGCCCCTTCCACCCGGTGCGCAGAGCGGCTGTGA

AGATTTTGGTACATTC GCTCTTCAGCATGCTCATCATGTGCACCATCCTAACCAACTGTGTGTTCATGGCACAACACGACCCTCCGCCTTGGACCAAAT

ATGTTGA GTACACCTTCACCGCCATCTACACCTTTGAGTCTCTGGTCAAGATTCTAGCTCGAGGCTTCTGCCTGCATGCGTTCACCTTCCTCCGGGACC

CGTGGAACTGGCTAGACTTCAGTGTGATCGTCATGGC ATACACAACTGAATTTGTGGACCTGGGCAATGTCTCAGCCTTACGCACCTTCCGAGTCCTCC

GGGCCCTGAAAACTATATCGGTCATTTCAG GCCTGAAGACAATCGTGGGAGCCCTAATCCAGTCTGTGAAGAAGCTAGCCGATGTGATGGTCCTTACTG

TCTTCTGCCTCAGTGTCTTTGCCCTCATTGGCCTGCAGCTCTTCATGGGCAACCTGAGGCACAAGTGCGTGCGTAACTTTACTGAGCTCAATGGCACCAA

TGGTTCCGTGGAGGCCGATGGCATAGTCTGGAACTCTCTGGACGTCTACCTCAATGACCCAG CCAATTACCTACTCAAGAATGGCACCACGGATGTGTT

GCTGTGTGGGAACAGCTCTGATGCCGG GACATGTCCTGAAGGCTACCGGTGCCTGAAGGCAGGTGAGAACCCTGACCACGGTTACACCAGCTTCGACTC

CTTCGCCTGGGCTTTCCTTGCGCTCTTCCGCCTGATGACACAGGACTGCTGGGAACGTCTATACCAGCAG ACCCTGAGGTCCGCAGGAAAGATCTACAT

GATCTTCTTCATGCTTGTCATATTCCTGGGCTCCTTCTACCTTGTGAACTTGATCCTGGCTGTGGTGGCCATGGCTTACGAGGAGCAAAACCAAGCCACC

ATCGCCGAGACGGAAGAGAAGGAGAAGCGTTTCCAGGAGGCCATGGAGATGCTCAAGAAGGAACACGAG GCTCTCACCATCAGGGGCGTGGATACTGTG

TCCCGTAGCTCTCTGGAGATGTCTCCTTTGGCCCCAGTAACCAACCATGAGAGAAGGAGCAAGAGGAGGAAACGACTGTCTTCAGGGACAGAGGATGGCG

GAGATGACAGGCTCCCCAAGTCGGACTCAGAAGACGGTCCCAGAGCATTG AATCAGCTCAGCCTCACCCATGGGCTCAGCCGGACATCCATGAGGCCCC

GCTCCAGCCGAGGGAGCATTTTCACATTCCGGCGACGGGACCAAGGCTCCGAGGCAGATTTTGCAGATGACGAGAACAGTACAGCAGGAGAGAGCGAGAG

CCACCGCACATCGCTGCTGGTGCCCTGGCCCCTGCGCCGTCCCAGCACCCAAGGGCAGCCCGGCTTTGGAACCTCAGCTCCTGGTCATGTCCTCAATGGC

AAAAGAAACAGCACCGTGGACTGCAATGGGGTGGTTTCCTTGCTGGGGGCAGGGGACGCAGAGGCCACCTCTCCAGGGAGCCACCTTCTCCGCCCTATAG

TGCTGGACAGACCCCCAGACACG ACCACGCCGTCAGAGGAGCCGGGTGGGCCCCAGATGCTGACACCGCAGGCTCCATGTGCAGATGGCTTTGAGGAGC

CCGGGGCACGGCAACGGGCACTCAGCGCCGTCAGTGTCCTCACCAGCGCTCTGGAAG AGTTGGAGGAGTCCCACCGTAAGTGTCCACCATGCTGGAATC

GCTTTGCCCAGCATTACCTCATCTGGGAGTGCTGCCCACTCTGGATGTCCATCAAGCAGAAGGTGAAGTTCGTGGTCATGGACCCGTTTGCTGACCTCAC

CATCACCATGTGCATCGTGCTCAACACGCTCTTCATGGCTCTGGAGCACTACAACATGACAGCCGAGTTTGAGGAGATGCTGCAGGTCGGAAACTTG GT

CTTCACGGGAATCTTCACGGCAGAGATGACCTTCAAGATCATCGCCCTTGACCCATACTACTACTTCCAGCAGGGCTGGAATATCTTCGACAGCATCATC

GTCATCCTCAGCCTCATGGAGCTGGGCCTGTCTCGCATGGGCAACCTGTCTGTGCTGCGTTCCTTCCGTCTG CTGCGGGTCTTCAAGCTGGCCAAATCA

TGGCCCACCCTGAACACACTCATCAAGATCATCGGGAACTCTGTTGGTGCCCTGGGGAACCTGACCCTGGTGCTGGCCATCATCGTCTTCATCTTCGCCG

TGGTGGGTATGCAGCTCTTCGGCAAGAACTACTCAGAGCTGAGGCACCGAATCAGCGACTCTGGCCTGCTGCCCCGCTGGCACATGATGGACTTCTTCCA

CGCCTTCCTCATCATCTTCCGCATCCTCTGTGGAGAGTGGATCGAGACCATGTGGGACTGCATGGAGGTGTCTGGGCAGTCGCTGTGCTTGCTGGTCTTC

CTGCTGGTCATGGTCATTGGCAACCTTGTG GTCCTGAATCTCTTCTTGGCCTTGCTGCTCAGCTCCTTCAGCGCAGACAACCTCACAGCCCCTGACGAG

GATGGGGAGATGAACAACCTCCAGCTGGCCCTGGCTCGCATCCAAAGGGGCCTTCGCTTTGTCAAGCGGACCACCTGGGACTTCTGCTGCGGGCTCCTGC

GGCGGCGACCTAAGAAGCCCGCGGCTCTTGCCACCCACAGCCAGCTGCCCAGCTGTATCGCCGCTCCCAGGTCCCCACCACCCCCAGAGGTGGAGAAGGC

GCCCCCAGCCCGCAAGGAAACACGGTTCGAGGAAGACAAGCGGCCGGGCCAGGGCACCCCTGGGGATACCGAGCCTGTGTGTGTTCCCATCGCAGTGGCT

GAGTCAGACACTGATGACCAGGAAGAGGATGAGGAGAACAGCCTTGGCACGGAGGAGGAAGAGTCCAGCAAACAG GAATCCCAAGTTGTGTCTGGTGGC

CACGAGCCCCCCCAGGAGCCCAGGGCCTGGAGCCAGGTGTCAGAGACCACATCCTCTGAAGCCGAGGCCAGTACGTCTCAGGCAGACTGGCAGCAAGAGC

GGGAAGCGGAGCCCCGGGCCCCGGGGTGCGGTGAG ACTCCCGAGGACAGTTACTCCGAGGGTAGCACCGCTGACATGACCAACACCGCAGACCTCCTGG

AGCAAATCCCAGACCTCGGGGAGGACGTCAAGGACCCAGAGGACTGCTTCACTGAAG GCTGCGTCCGACGTTGTCCTTGCTGCATGGTGGACACGACGC

AGGCCCCAGGGAAGGTCTGGTGGAGACTGCGCAAGACCTGCTACCGCATAGTGGAGCACAGCTGGTTCGAGACTTTCATCATCTTCATGATCCTGCTCAG

CAGCGGAGCGCTG - UNI23176 - GCCTTCGAGGACATCTACCTGGAGGAGCGGAAGACCATCAAGGTTCTGCTGGAGTACGCCGACAAGATGTTCA

CCTATGTCTTTGTGTTGGAGATGCTGCTCAAGTGGGTGGCCTACGGCTTCAAGAAGTACTTCACCAACGCCTGGTGCTGGCTGGACTTCCTAATTGTGGA

C GTCTCACTGGTCAGCCTCGTGGCCAACACCTTAGGCTTTGCCGAGATGGGTCCCATCAAGTCCCTGAGGACACTGCGTGCACTTCGACCCCTGAGGGC

TTTGTCACGATTCGAGGGCATGAGG GTGGTGGTCAACGCGCTGGTGGGCGCCATCCCCTCCATCATGAATGTCCTCCTCGTCTGCCTCATCTTCTGGCT

CATCTTCAGCATCATGGGCGTGAACCTCTTCGCCGGGAAGTTCGGTAGGTGCATCAACCAGACCGAAGGGGACCTGCCTCTGAACTACACCATTGTGAAC

AACAAGAGCGAGTGTGAGTCCTTCAACGTGACTGGAGAGTTGTACTGGACCAAGGTGAAAGTCAACTTTGACAACGTGGGGGCTGGGTACCTGGCCCTGC

TGCAGGTG GCGACATTTAAAGGCTGGATGGACATCATGTATGCGGCTGTGGACTCCAGAGGG TATGAAGAGCAGCCGCAGTGGGAGGACAACCTCTAC

ATGTACATCTACTTCGTCGTCTTCATCATCTTCGGCTCCTTCTTCACCCTCAACCTGTTTATTGGTGTCATCATTGATAACTTCAACCAGCAGAAGAAAA

AG TTAGGGGGCCAGGACATCTTCATGACGGAGGAGCAGAAGAAGTACTACAATGCCATGAAGAAGCTGGGCTCCAAGAAACCCCAGAAGCCCATCCCAC

GGCCTCTG AACAAGTACCAGGGTTTCATATTCGACATTGTGACCAAGCAGGCCTTCGATGTTACCATCATGTTCCTCATCTGTTTAAACATGGTGACCA

TGATGGTAGAGACAGATGATCAGAGCCCTGAAAAAGTCAACATCTTGGCCAAGATCAACCTGCTCTTCGTGGCCATCTTCACAGGAGAGTGTATTGTCAA

GATGGCTGCCCTGCGCCACTATTACTTCACCAACAGCTGGAACATCTTCGATTTCGTGGTTGTCATCCTCTCCATCGTTG GCACTGTCCTCTCCGACAT

CATCCAGAAGTACTTCTTCTCCCCAACGCTCTTCCGTGTCATCCGTCTGGCCAGGATCGGCCGCATCCTCAGGCTGATCCGAGGAGCCAAGGGGATTCGC

ACGTTGCTCTTCGCCCTCATGATGTCCCTGCCCGCCCTCTTCAACATCGGCCTCCTCCTCTTCCTCGTCATGTTCATCTACTCCATCTTCGGCATGGCCA

ACTTTGCCTACGTCAAGTGGGAGGCTGGCATCGACGACATGTTCAACTTCCAGACCTTTGCCAACAGCATGCTGTGCCTTTTCCAGATCACCACGTCGGC

TGGCTGGGATGGCCTCCTCAGCCCCATCCTCAACACAGGACCCCCCTACTGTGACCCCAACCTGCCCAACAGCAATGGCTCCAGGGGGAACTGTGGGAGC

CCAGCAGTGGGCATCCTCTTCTTCACCACCTACATCATCATCTCCTTCCTCATCGTGGTCAACATGTACATTGCCATCATCCTGGAGAACTTCAGTGTGG

CCACAGAAGAGAGCACAGAGCCCCTGAGCGAGGATGACTTCGACATGTTCTATGAGATCTGGGAGAAGTTCGACCCGGAGGCCACCCAGTTCATTGAGTA

TTTGGCCCTGTCCGACTTTGCCGATGCCCTGTCTGAGCCACTCCGCATCGCCAAGCCCAACCAGATAAGCCTCATCAATATGGACCTGCCCATGGTGAGC

GGGGACCGCATCCACTGTATGGACATCCTGTTCGCCTTCACCAAGAGGGTGCTCGGGGAGTCTGGGGAGATGGATGCCCTGAAGATCCAGATGGAGGAGA

AATTCATGGCGGCCAATCCTTCCAAGATCTCCTATGAGCCCATCACCACCACCCTGCGGCGAAAACATGAGGAGGTGTCGGCCACGGTCATCCAGCGGGC

CTTCCGGAGGCACCTCCTGCAGCGCTCGGTGAAGCATGCTTCCTTCCTCTTCCGCCAGCAAGCGGGCAGCAGTGGCCTCTCTGATGAGGATGCCCCCGAG

CGAGAGGGACTCATTGCCTACATGATGAATGAGAACTTCTCCCGGCGCAGCGGTCCCCTCTCCAGCTCTTCCATCTCCTCCACGTCCTTCCCACCGTCCT

ATGACAGCGTCACGAGGGCCACCAGTGATAACCTCCCAGTGCGTGCGTCGGACTACAGCCGCAGCGAAGATCTTGCAGACTTCCCTCCATCTCCAGATAG

GGACCGAGAGTCTATAGTGTGAACCTGGCCACCCGTCCGGCCAGGACGTGCCCTGTTGTATCCTGACAAACCTTAAGCAGTTGAAACCAGTGTCGGCTAA

GGCCTTCCTAGCTCTGGAGGTGACAGGGGAACCTCCAGGTGGAGGAACCACACGGCAGAGTTCTGTGTGTCTGTGTTGAAGCTAGAGGCGGCTAGAGCAA

CCCTGGCTGGTAGAGGCCTGGCACACCCTAGTAGCCGGGTCTGGCCAGGCAGCGCCGCATGGCTCTGAACAGCAACTCTGTCCCCCTCTGAGGTGAAACG

GGAAACACACTGTACATGTTGTGAACAAGCTTTCATAGGTTTATTATATTTGATATTTTTTTACTCGAGCAAAGAACATCTTTTTCCATGAACATCTGCA

GCAGTTCACACGGCCTCTTCCTAACCCTGAGCAGGTGTCAATGGAGAACTCTGCTCTCAGAGCTAACGTGGAATCTTCGCACCCAAGGGGAGGGTTGTGG

TTCCTGTCACCTGGGCTGAGGAGCCAGGAAGGCCTAAGCACTTCACTCACACACGCGAGTGGGCGAGTGCGTGTGCCTGTGCACACTTCACACACTGGGG

CGGGACATAGGCCGCAGGGACCCAGGGTCGCCTCAGGCAAATGTGGTTGGTCGGTGGCTCCAAAGGCGAGAGGTTTTTCTTCCTGGCCCCCCAGTGTGGG

TTTCTTCCTGTGAACTCACTCTGTGCCCCTGTTGTCCACAGGATTCCAGTCTCCTGTTCTCAGTCAGGCTTCGCTTGAGGTCAGTGCTATAAAAATTGAA

AGCTTCCAGAGAGCTGCCCTGGTCTCCCTTCCTCTCCTGTAAGAGTATTAATGTTGGGGCCCAAGGGCTCGAGGAAGGCAGCCTCGCTCACAGCCAGGCA

CGTAGCTTGCTTCTGAGATGTGGCAGGCCCTGTCCCAAGGCCAAGGGAGGAGAAGGCTGTCCCACGTGGGCCGCTGAACTGTGTCCAGCTGTGGCAGCAA

AGGGAGCGGTCTCCATTTCCCAGGCTCCTCTGGGGTCTCTGCCTCTGGCCGTGTGTCAAGGAGATGCCCACTGGGGCTCCAACCGTCTTCAGACACTGTG

GAAGTGGGAGGGTAGCCTGGCCCTGTCTAGGAGAAAGGCCCTGCGTGGTCAGGCCTGGTTCTGTGACCTGGAAGGTGACAAGCCATCCATCCCCCATGGG

AGAGGAGACAGTGTGGCATCTGGGCCCAGCCCAGGGTCTGACTATCCTAGGCGTCTTCTGAGAAGGCTTTTTCAGG
Translation
 MANFLLPRGTSSFRRFTRESLAAIEKRMAEKQARGSATSQESREGLPEEEAPRPQLDLQASKKLPDLYGNPPRELIGEPLEDLDPFYSTQK TFIVLNK

GKTIFRFSATNALYVLSPFHPVRRAAVKILVHS SLFSMLIMCTILTNCVFMAQHDPPPWTKYVE EYTFTAIYTFESLVKILARGFCLHAFTFLRDPWN

WLDFSVIVMA AYTTEFVDLGNVSALRTFRVLRALKTISVISG GLKTIVGALIQSVKKLADVMVLTVFCLSVFALIGLQLFMGNLRHKCVRNFTELNGT

NGSVEADGIVWNSLDVYLNDPA ANYLLKNGTTDVLLCGNSSDAG GTCPEGYRCLKAGENPDHGYTSFDSFAWAFLALFRLMTQDCWERLYQQ TLRSA

GKIYMIFFMLVIFLGSFYLVNLILAVVAMAYEEQNQATIAETEEKEKRFQEAMEMLKKEHE ALTIRGVDTVSRSSLEMSPLAPVTNHERRSKRRKRLSS

GTEDGGDDRLPKSDSEDGPRAL NQLSLTHGLSRTSMRPRSSRGSIFTFRRRDQGSEADFADDENSTAGESESHRTSLLVPWPLRRPSTQGQPGFGTSAP

GHVLNGKRNSTVDCNGVVSLLGAGDAEATSPGSHLLRPIVLDRPPDT TTPSEEPGGPQMLTPQAPCADGFEEPGARQRALSAVSVLTSALEE ELEESH

RKCPPCWNRFAQHYLIWECCPLWMSIKQKVKFVVMDPFADLTITMCIVLNTLFMALEHYNMTAEFEEMLQVGNL VFTGIFTAEMTFKIIALDPYYYFQQ

GWNIFDSIIVILSLMELGLSRMGNLSVLRSFRL LRVFKLAKSWPTLNTLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKNYSELRHRISDSGLL

PRWHMMDFFHAFLIIFRILCGEWIETMWDCMEVSGQSLCLLVFLLVMVIGNLV VLNLFLALLLSSFSADNLTAPDEDGEMNNLQLALARIQRGLRFVKR

TTWDFCCGLLRRRPKKPAALATHSQLPSCIAAPRSPPPPEVEKAPPARKETRFEEDKRPGQGTPGDTEPVCVPIAVAESDTDDQEEDEENSLGTEEEESS

KQ ESQVVSGGHEPPQEPRAWSQVSETTSSEAEASTSQADWQQEREAEPRAPGCGE TPEDSYSEGSTADMTNTADLLEQIPDLGEDVKDPEDCFTEG G

CVRRCPCCMVDTTQAPGKVWWRLRKTCYRIVEHSWFETFIIFMILLSSGAL - UNI23176 - AFEDIYLEERKTIKVLLEYADKMFTYVFVLEMLLK

WVAYGFKKYFTNAWCWLDFLIVD VSLVSLVANTLGFAEMGPIKSLRTLRALRPLRALSRFEGMR VVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNL

FAGKFGRCINQTEGDLPLNYTIVNNKSECESFNVTGELYWTKVKVNFDNVGAGYLALLQV ATFKGWMDIMYAAVDSRG YEEQPQWEDNLYMYIYFVVF

IIFGSFFTLNLFIGVIIDNFNQQKKK LGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPL NKYQGFIFDIVTKQAFDVTIMFLICLNMVTMMVETDD

QSPEKVNILAKINLLFVAIFTGECIVKMAALRHYYFTNSWNIFDFVVVILSIVG GTVLSDIIQKYFFSPTLFRVIRLARIGRILRLIRGAKGIRTLLFA

LMMSLPALFNIGLLLFLVMFIYSIFGMANFAYVKWEAGIDDMFNFQTFANSMLCLFQITTSAGWDGLLSPILNTGPPYCDPNLPNSNGSRGNCGSPAVGI

LFFTTYIIISFLIVVNMYIAIILENFSVATEESTEPLSEDDFDMFYEIWEKFDPEATQFIEYLALSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIH

CMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSATVIQRAFRRHLLQRSVKHASFLFRQQAGSSGLSDEDAPEREGLI

AYMMNENFSRRSGPLSSSSISSTSFPPSYDSVTRATSDNLPVRASDYSRSEDLADFPPSPDRDRESIV

For any suggestions or comments, please send an email to unitrap@crg.es