Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032512 (Wdr48)
Chromosomal location
Chr 9: 119804013 - 119834786 (+)
Description
WD repeat domain 48 Gene [Source:MGI Symbol;Acc:MGI:1914811]
RefSeq_dna
NM_026236 
RefSeq_peptide
NP_080512.1 
UniGene
Mm.476306 
MGI
MGI:1914811 
Uniprot/SWISSPROT
Q8BH57 
Human Ortholog
ENSG00000114742 (WDR48)
Omim not available
UniTrap UNI32071
Vector Insertion
Chr 9: 119804076 - 119811403
Public Clones IST10351H4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6267
Vector Insertion
Chr 9: 119811545 - 119813395
Public Clones CSD197 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2565
Vector Insertion
Chr 9: 119822844 - 119825843
Public Clones XS0251 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000036561
Sequence
GTGTCAACATGCAAGATGGCGGCCCATCACCGGCAGAACACAGCCGGGCGGAGGAAAGTGCAG - UNI32071 - GTTTCTTATGTAATTCGAGATGA

AGTGGAGAAATACAATCGGAATGGAGTCAATGCCCTGCAACTGGACCCAGCACTCAACAGACTCTTCACAGCAGGTCGAGACTCCATCATAAGAATATGG

AGTGTCAATCAGCACAAG - UNI6267 - CAAGATCCGTACATAGCATCTATGGAGCACCATACAGACTGGGTAAATGATGTCGTGCTCTGTTGCAAT

GGGAAAACGC TAATTTCTGCTTCTTCAGACACAACAGTCAAAGTCTGGAATGCACATAAAGGGTTCTGCATGTCCACACTCAGGACGCATAAG GACTA

TGTAAAGGCCTTAGCGTACGCCAAGGATAAAGAGCTGGTAGCGTCAGCTGGGCTGGACAGACAGATATTCCTTTGGGATGTGAACACTCTGACGGCACTG

ACTGCCTCAAACAACACCGTTACAA CTTCTTCTTTAAGTGGGAACAAAGACTCCATTTATAGCCTGGCCATGAACCAACTGGGAACAATCATTGTATCA

GGGTCCACTGAGAAG GTTCTGAGAGTGTGGGATCCAAGAACCTGCGCGAAACTCATGAAGCTGAAAGGACATACGGACAATGTGAAGGCCTTGCTGCTG

CACAGGGACGGCACACAG TGCCTCTCTGGGAGTTCTGACGGGACCATTCGCCTGTGGTCCCTTGGCCAGCAGAGATGTATAGCAACATACCGAGTCCAT

GATGAAGGTGTTTGGGCCCTACAGGTCAACGATGCCTTTACACATGTATATTCTGGAGGACGAGACAGGAAAATCTACTGCACAGACCTAAGGAACCCTG

ACATTCGGGTACTGATTTGTGAAGAAAAAGCACCAGTTCTCAAG ATGGAACTTGACAGATCAGCAGATCCCCCTCCTGCAATCTGGGTTGCAACAACAA

AGTCCACAGTAAATAAGTGG ACACTGAAGGGAATTCATAATTTTCGAGCCTCTGGTGATTATGACAATGATTGTACAAACCCCATAACGCCCCTCTGCA

CACAGCCCGACCAAGTTATTAAAG GGGGCGCTAGTATTATTCAGTGCCACATCCTAAATGACAAGCGACACATATTAACCAAAGATACGAATAACAATG

TGGCGTACTGGGATGTATTGAAG - UNI2565 - GCATGCAAAGTGGAAGATTTGGGCAAAGTGGACTTTGAAGATGAAATTAAGAAAAGATTTAAAA

TGGTGTATGTTCCAAATTGGTTCTCAGTAGACCTAAAAACAGGG ATGCTGACCATTACCCTGGATGAGAGTGACTGCTTCGCTGCCTGGGTTTCTGCGA

AAGATGCTGGCTTTAGCAGTCCTGATGGGTCAGACCCAAAAC TGAACTTAGGAGGACTTCTACTACAGGCACTGCTGGAATACTGGCCCAGGACACATG

TGACTCCCATGGATGAAGAAGAGAATGAAGTGAACCATG TGAGTGGGGGACAGGAGAGCAGAGTCCAGAAGGGAAATGGTTATTTCCAAGTGCCCCCAC

ACACCCCGGTGATCTTTGGAGAAGCTGGAGGTCGCACACTATTCAG GCTGCTCTGCCGGGACTCCGGGGGTGAGACTGAGGCGATGCTTCTCAATGAGA

CGGTGCCACAATGGGTGATTGACATCACTGTGGAT AAAAATATGCCCAAATTCAACAAAATTCCTTTCTACCTCCAACCTCATGCATCTTCAGGAGCAA

AAACTTTAAAAAA AGACAGGCTGTCTGCCAGTGACATGCTGCAGGTCCGGAAGGTGATGGAGCACGTCTACGAGAAGATTATCAACCTGGACAATGAGT

CCCAAACCACCAGCTCTTCTAATAATGAAAAGCCAGAGCAGGAGAAGGAGGAGGACATCGCGGTATTGGCAGAGGAGAAAATTGAACTTCTGTGCCAGGA

CCAG GTTTTGGACCCAAATATGGACCTTCGGACAGTAAAGCACTTCATATGGAAGAGTGGTGGGGACCTCACCCTCCATTACCGTCAGAAGTCCACGTG

AGGGTGGGCCCATGCTCCTGGGTTCTTCACCAACCACCTTTCTCTGTGGCCCCAAGAGTAGTCCTAGGAAGCCCACCACGTCCTACGGGAGCAAGACCTC

CAACCGGCCTATTTGGTGACGTGACTAATGGAGATGTAATATAGAAACCAGGCTCCATGCATAGATTAAGGTGTCCCCAGGGACTCAAGAGTGCAAGGAC

AAGCCCCTGGCACTGTCCGGGGAGATGTACAGAGAATCTACAACAGGCCAGTGCAGACTTCGCTGACTCCTTTTGAAGGACCCCCCTTTGTCTCTTAGCA

CTTGTTAGAGAACATCAGCGGGGCCACATCAGTCGCCATGTTTCAGTTTCAAACCCACAGGCTCTGCAGCTTTTCCAAGTACATTCCACTCATGCAGTAC

CTATGAAGGCTTTTTCCAAATTTGTCATTATATAAAAAAAAACAAGTTGTTTTCACTATGTAAGAGTTATTTTTAATGGAAATCACTGTTGCACAATTCA

AGAGCCAGCCCATTTCCTGAGAAATGACCATGTTGGGCTACTTTTGAAATGCCACGTCTCAGCTGTGCTCTTGTAGGAAGACCTGCAACTCCAGGGCTGG

AGCCTGCGCAGCACGTGGACCTGCAGGCTGCCACCCACAGCCTGTGCTGCGCAGTGCTGCCCATGGCGCCCTGGCTGTCCGATAGCCCAAGCTGCTGTGG

CCACTCCTTCCGCCAGTCTTCCTCGCGGGCAAAGCCAGCGAAGCCACAGCTTCCTGCTCCGCGTGAGCAGCACGACAACTGTCAGAACTTACGGCCATGC

TGAAGTTGCAGTTTCATTCAGATGCTACCTAAAGTTTATGTTACTAGAGTAAAAAGATCTCACAG
Translation
MAAHHRQNTAGRRKVQ - UNI32071 - VSYVIRDEVEKYNRNGVNALQLDPALNRLFTAGRDSIIRIWSVNQHK - UNI6267 - QDPYIASMEH

HTDWVNDVVLCCNGKTL LISASSDTTVKVWNAHKGFCMSTLRTHK DYVKALAYAKDKELVASAGLDRQIFLWDVNTLTALTASNNTVTT TSSLSGNK

DSIYSLAMNQLGTIIVSGSTEK VLRVWDPRTCAKLMKLKGHTDNVKALLLHRDGTQ CLSGSSDGTIRLWSLGQQRCIATYRVHDEGVWALQVNDAFTH

VYSGGRDRKIYCTDLRNPDIRVLICEEKAPVLK MELDRSADPPPAIWVATTKSTVNKW TLKGIHNFRASGDYDNDCTNPITPLCTQPDQVIKG GGAS

IIQCHILNDKRHILTKDTNNNVAYWDVLK - UNI2565 - ACKVEDLGKVDFEDEIKKRFKMVYVPNWFSVDLKTG MLTITLDESDCFAAWVSAKDA

GFSSPDGSDPKL LNLGGLLLQALLEYWPRTHVTPMDEEENEVNHV VSGGQESRVQKGNGYFQVPPHTPVIFGEAGGRTLFR RLLCRDSGGETEAMLL

NETVPQWVIDITVD KNMPKFNKIPFYLQPHASSGAKTLKK KDRLSASDMLQVRKVMEHVYEKIINLDNESQTTSSSNNEKPEQEKEEDIAVLAEEKIE

LLCQDQ VLDPNMDLRTVKHFIWKSGGDLTLHYRQKST

For any suggestions or comments, please send an email to unitrap@crg.es