Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032514 (Ttc21a)
Chromosomal location
Chr 9: 119846765 - 119876895 (+)
Description
tetratricopeptide repeat domain 21A Gene [Source:MGI Symbol;Acc:MGI:1921302]
Human Ortholog
not available
Omim not available
UniTrap UNI36131
Vector Insertion
Chr 9: 119855930 - 119859718
Public Clones IST11364G1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035100
Sequence
GTGAGCTGGGCTGCGAATTGGGCGGCCAGAGCTGGGAATCCCGCTCAGCCGGTCATCACCTGAGCCGGGCTGCAGCCATGAGCAGCGATGACTCCTCTCT

CATG GCTTCGATCATTTACTACAGCCAGGAAAAGTACTTCCACCATGTGCTGCAGGCTGCGAATGTGGGCCTAGAGAGGTACAGCAGCGACCCAGCCCT

GCAGTTCTTCAGAGCGTATGGAATCCTTGGGGAAG ACCACATCCACGATGCCATCAGCGAGCTGGAAGGCATCCAAAGCCACCCAGACACGTCCCTGTG

CGCGGTCATCGCCCTGCTTTCTGCTCACAAATCCTGCGACACCATCG ACATAGAAGCAGTTCAGGAACTGGAGAGCAGCTTGAAGGAAATTCGCAGGTC

AGCCAGCAGCACTGCTCTGTACTACGCCAGCCTCTTCCTCTGGTTCATGGGTCACCACGACAAGGCCAGGGAGTATGTTGACCACATGTTGAAGGTCTCC

AGCGGCTCCAAAGAG GGCTATGTGCTCAAAGGCTGGGTGGACCTTACCTCCAGTAAACCCCACGTTGTGAAGAAATCCATCAAGTACCTGGAACAAGGA

ACTCAAGACACCAAAGATGTGCTAGGGCTCATGGGCAAG GCAACGTACTTCATGACACAACAGAACTTCTCTGGGGCCCTGGAGGTGGCGAACCAGGTC

ACCTTGGCCTGCAGCAACTTCCTGCCCGCTTTAGTCCTGAAGATGAAGCTGTTCCTGGCTCGGCAGGATTGGGATCAGACGATAGAAACCGGACAAAG A

ATCCTTGAAAAAGACGAAAACAATATTGATGCCTGGCAAATTCTAGCTGTGCACGAGCTGGTGAAAGAAGGGAACACGGACAGA GCTGCCGACCGGGTC

AGAAACCTCATCAAGGCGCTAGAGACTGGAGAGCCCCACAATCCAAACCTACATCTTAAGAAGATCCTTGTAATCAGCAGGCTG TGTGGGAGGCACCAG

GTGGTCCATCGGCTTGTGAGCGGCTTCCTGGAGCGCATCTTTATGGCCACACCTTCCTGTGCCCTTGTGGCCACAGAGCTGGGCTACCTCTTCATCCTAC

ACCAACAAGTGAAGGAAGCCTGTCTGTGGTACAAGGAGGCCATGAAGCTGGAGGAGAACAGGCTGGCTGCCTTGGCAG - UNI36131 - GGAGCATC

TGGTGCCAGATCCTACAGGGCCAGCTGGAGGAGGCTGCTCACCAGCTGGAGTTCCTCAAGGAGGTGCAGCAGTCCCTTGGGAAGTCTGAG TTGCTGGTT

TTCCTGCAAGCCCTCGTAGCAGCTAAGAAGCAAAGGCTGGAGCAGGAGGCCACGGCGCTCCTGAAGGAGGCGGTGGAAGTGCACTTCTCCAGCATGCAGG

GTCTGGCCCTGAGCCCCGAGTACTTTGAAAAGCTGGACCCCCTCTTTCTGGTCTGCATCGCCAAGGAGTATCTGCATTTCTGCCCCAAGCAG CCCCGGT

CACCCGGCCAGCTCGTATCTCCACTTCTTAAACAAGTCGCCATGATCTTGAGTCCTGTGGTGAAGGTGGCCCCGGCCATGATGGAGCCACTGTATGTAAC

GGCTCAGGTCAAGTTCCTCTCAG GAGAGCTGGAAAATGCGCAGAGCACCCTGCAGCGCTGCCTGGAGCTGGACCCCACATTTGTGGATGCTCACCTCCT

CATGTCCCAGATCTACCTGGCCCAGGGCAACTTCGCCATGTGCTCCCATTGCCTAGAGCTGGGTGTCAGCCACAACTTCCAG GTCCGAGACCATCCCCT

CTACCACTTCATCAAAGCCAGGGCCCTCAATAAGACGGGCGACTATGCCGAGGCCATAAAGACCTTAAAAATGATCATAAAGGTTCCCACCTCGAAGGCA

GAAGAGGGCAGGAAGTCCCAAAGCCCCTCCGTTCGGCCCAGCGAGCGGGCATCCATCCTGCTAGAGCTAGTAGAGGCTCTCCGACTGAATGGGGAACTG 

CACGAGGCCACCAAGATCATGCAGGACGCCATCAATGAGTTCAGCGGCACGCCAGAGGAGATGCGCATCACGGTCGCCAACGTGGACTTGGCTCTGAGCA

AGGGCAACGTGGACCTGGCGCTGAACATGTTAAGAGGTATCACACCCAAGCAACCCTGCTACACAGAAGCCAAGGAGAAGATGGCCAGTATCTACCTGCA

CACTCGCAAGGACGTGCGCCTCTACATTGGCTGCTACGT GGAGCTTTGTGAACATCTGCCCGGCCCCCACAGCAGCCTGCTACTGGGTGACGCTTTCAT

GAACATTCAGGAG CCTGAGAAGGCCCTGGAGGTGTATGACGAGGCCTATAGAAAGAACCCTCACGATGCCTCCTTGGTCAGCAGGATCGGACAGGCCTA

CGTGAAGACCCACCAGTACGCCAAG GCCATTAATTACTACGAGGCTGCCCAGAAGATCAGCGGGCAGGACTTCCTGTGCTGCGAGCTGGCCGAGCTCCT

CCTCAAGCTGAAGAAATACCACAAGGCAGAGAAGGTGCTGAAGCAGGCCTTGGAGCGAGACTCAG GGGTCAAGGACATCCCATCCATGATAAATGAGGT

CAAGTGCTTGCTTTTGTTGGCAAAGGTTTACAAGAGCCACAAGAAGGAAGAGGTGATGGAAACCCTGAATCTG GCCTTGGACCTCCAGTCCCGGATACT

GAAGCGGGTTCCTTTGGAGCAATCAGAAATGATCCCCTTCCAGAATCAGCTGGCAGCCTCCATCTGCATCCAGATTGGGGAACATCACCTGGCGGAGAAA

GATTACGACAGCGCCCTGAAATCCTATAAGGACGCCCTCGCCTACTCGCCCACAGACAGTAAG GTGGTGCTGGAGCTGGCCCATCTCTACCTGCTTCTG

GGTCAGCTGGACCTGTGTGAACAGCGCTGTGCCCCCCTCTTAGAGATGGAGCAGACCCACGAGAGAGCCGCTGTG ATGCTGGCCGACCTGATGTTTAGA

AGACAAAACTATGAAACTGCCATCAATCTCTACCACCAAGTGCTGGAGAAAGCTCCAG ACAATTTTTTGGTATTGAATAAACTGGTCGATCTGCTACGA

CGGAGCGGCAAGCTTGAAGAGGCCCCTGCTTTCTTTGAACTGGCCAAGAAGGTGTCTAGCCGGGTGCCTTTGGAGCCAGGGTTTAACTACTGCCAAGGCA

TTTACTTCTG GCACATTGGACAGCCCAATGAAGCCTTGAGGTTTCTGAACAAAGCCCGAAAGGACAGCACTTGGGGCCAGCTTGCCACCTGTTACATGG

TACAGATCTGTCTGAACCCTGACAATGAGATTGTCGGTGGAGAGGCTTTTGAGAGCCTGGTGGGTGACAGCAA CTCTGCCAGTAGAAAGGAGTCTCAGC

AGCACGGGGTGCGCACTGCAGAGAAGCTACTTCGGGAATTTTACCCACACTCGGAATCCGGGCAGACCCAGCTGCGGCTGCTGCAGAATCTCTGCCTGCT

GGCCACCAGGGAGAAGGCGAATGTAGAGGTGGCTCTGGGAGCCTTTATCGAGATGGCCCAGGCTGAG AAGGACAGCATCCCTGCACTGCTGGCCATGGC

GCAGGCCTACATACTCCTGAAGCAAGTCCCCAAGGCCCGAACGCAGCTGAAGCGCCTGGCCAAAGTCCCATGGACGGTCGACGAGGCCGAAGACCTGGAA

AAGAGCTGGCTTCTGTTGGCAGATATCTATTGCCAAGGCGGCAAGTTCGACCTGGCCTTGGAGCTACTGCGCCGATGCCTGCAGTATAACAAG TCTTGC

TGCCGGGCCTATGAGTACATGGGCTTCATCATGGAGAAAGAGCAGTCATACAAGGATGCAGCAACCAACTACGAGCTGGCCTGGAAGTACAGTCATCAGG

CCAACCCCGCCATTG GTTTCAAACTGGCTTTCAACTACCTGAAAGACAAGAAGTTCGTAGATGCCATTGAAGTCTGTCACAGC GTCCTGACGGAGCAC

CCCAAGTACCCCAAGATCAGGGAGGAGATTTTGGAGAAAGCCCAAGGGTCCTTGAGGCCCTAGCTGTGGCTGGAAGGGGCTTGGGCAGGGAGAAGCATCA

GTCTATAGACGACGACGGTTCAGGGGGGGAGTAGGAAGTAAAACCGTGGAGAGGCAAGTGAGAAAC
Translation
MSSDDSSLM ASIIYYSQEKYFHHVLQAANVGLERYSSDPALQFFRAYGILGED DHIHDAISELEGIQSHPDTSLCAVIALLSAHKSCDTID DIEAVQ

ELESSLKEIRRSASSTALYYASLFLWFMGHHDKAREYVDHMLKVSSGSKE GYVLKGWVDLTSSKPHVVKKSIKYLEQGTQDTKDVLGLMGK ATYFMTQ

QNFSGALEVANQVTLACSNFLPALVLKMKLFLARQDWDQTIETGQR RILEKDENNIDAWQILAVHELVKEGNTDR AADRVRNLIKALETGEPHNPNLH

LKKILVISRL CGRHQVVHRLVSGFLERIFMATPSCALVATELGYLFILHQQVKEACLWYKEAMKLEENRLAALAG - UNI36131 - GSIWCQILQG

QLEEAAHQLEFLKEVQQSLGKSE LLVFLQALVAAKKQRLEQEATALLKEAVEVHFSSMQGLALSPEYFEKLDPLFLVCIAKEYLHFCPKQ PRSPGQLV

SPLLKQVAMILSPVVKVAPAMMEPLYVTAQVKFLSG GELENAQSTLQRCLELDPTFVDAHLLMSQIYLAQGNFAMCSHCLELGVSHNFQ VRDHPLYHF

IKARALNKTGDYAEAIKTLKMIIKVPTSKAEEGRKSQSPSVRPSERASILLELVEALRLNGEL HEATKIMQDAINEFSGTPEEMRITVANVDLALSKGN

VDLALNMLRGITPKQPCYTEAKEKMASIYLHTRKDVRLYIGCYV VELCEHLPGPHSSLLLGDAFMNIQE PEKALEVYDEAYRKNPHDASLVSRIGQAY

VKTHQYAK AINYYEAAQKISGQDFLCCELAELLLKLKKYHKAEKVLKQALERDSG GVKDIPSMINEVKCLLLLAKVYKSHKKEEVMETLNL ALDLQS

RILKRVPLEQSEMIPFQNQLAASICIQIGEHHLAEKDYDSALKSYKDALAYSPTDSK VVLELAHLYLLLGQLDLCEQRCAPLLEMEQTHERAAV MLAD

LMFRRQNYETAINLYHQVLEKAPD DNFLVLNKLVDLLRRSGKLEEAPAFFELAKKVSSRVPLEPGFNYCQGIYFW WHIGQPNEALRFLNKARKDSTWG

QLATCYMVQICLNPDNEIVGGEAFESLVGDSN NSASRKESQQHGVRTAEKLLREFYPHSESGQTQLRLLQNLCLLATREKANVEVALGAFIEMAQAE K

DSIPALLAMAQAYILLKQVPKARTQLKRLAKVPWTVDEAEDLEKSWLLLADIYCQGGKFDLALELLRRCLQYNK SCCRAYEYMGFIMEKEQSYKDAATN

YELAWKYSHQANPAIG GFKLAFNYLKDKKFVDAIEVCHS VLTEHPKYPKIREEILEKAQGSLRP

For any suggestions or comments, please send an email to unitrap@crg.es