Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032519 (Slc25a38)
Chromosomal location
Chr 9: 120019517 - 120033435 (+)
Description
solute carrier family 25, member 38 Gene [Source:MGI Symbol;Acc:MGI:2384782]
RefSeq_dna
NM_144793 
RefSeq_peptide
NP_659042.1 
MGI
MGI:2384782 
Uniprot/SWISSPROT
Q91XD8 
Human Ortholog
ENSG00000144659 (SLC25A38)
Omim not available
UniTrap UNI19249
Vector Insertion
Chr 9: 120019691 - 120025619
Public Clones not available
Private Clones OST398576 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19955
Vector Insertion
Chr 9: 120025742 - 120026570
Public Clones IST14662C8 (tigm)
Private Clones OST376535 (lexicon) OST329489 (lexicon) OST238503 (lexicon) OST45850 (lexicon)
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6269
Vector Insertion
Chr 9: 120029966 - 120031211
Public Clones CSD220 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035106
Sequence
GTCTCGGGTAATGAGACCTGAGGCCGGGCGGGCAGGCGGGGAGGGATGGGCGTGAGCGCGGAGCCCCGGAGCCTCTCAGTCGCCGGGGCCGGGCTCGCGT

CCCCAGTGATCGAGAAGGCACGCTCGGCGCTGCTGCAGTCGCAGGATGTAGAGGACACGGTGGAGACGCTCATG - UNI19249 - TTACACCCAGTG

ATTAAGGCTTTCCTCTGCGGCTCCATCAGCGGGACCTGTTCCACGCTCCTCTTCCAGCCTTTGGATCTCCTCAAAACCCGTCTGCAGGCCCTGCAGCCCT

CAGACCTAGG - UNI19955 - GCCCAGACGTGTTGGGATGTTGGCTGTGTTCTTGAAGGTGGTTCGCACAGAAAGTCTCCTGGGCCTTTGGAAAGGG

ATGTCTCCT TCCATTGTGAGATGTGTCCCTGGAGTGGGGATCTACTTTGGCACCCTGTATTCTTCGAAGCAGTATTTCTTGCGAGGCCATCCTCCCACC

GCCCTGGAGTCGGTCATCCTGGGCATGGGCTCCCGCTCTGTGGCAGGAGTCTGCATGTCACCCATCACAGTGATCAAGACACGCTATGAG AGTGGGACT

TACAGCTATGAGAGCATCTATGCAGCCCTGAGGAGCATCTACTGCAGCGAGGGCCACCGTGGCCTCTTCAGGGGCCTGACAGCAACTCTCCTCCGTGATG

CCCCCTTCTCAGGGCTCTACCTGATGTTTTACAGTCAGACCAGGACCGCAGTGCTGCACGGCACAG - UNI6269 - CCCAGCTGGATGCTGCTCTGA

TACCCCTTATTAATTTCTCCTGTGGGATATTTGCTGGCGTTCTGGCTTCACTGGTGACTCAACCTGCAGACGTGATCAAAACTCACATGCAGCTCTCCCC

AGTGAAGTTTCAGTGGATTGGCCAAGCAGCCACTCTCATCTTCAAG AACCATGGGCTGCGTGGCTTCTTTCATGGCAGTGTTCCCCGAGCCCTCCGAAG

AACGCTGATGGCTGCCATGGCGTGGACCGTCTATGAAGAGATGATGGCCAGGATGGGCCTGAAGTCCTGACGAGAGAGAGCTGGTTCCTGCCATGAGCTG

CTGCAGCTCACTCCCGGAGTCAGGTGAAGACTGCGCTGTCTGAAGAGCCAGGCACAAGTGCCGTCACCTTTTTTCCAGAATTCAGAGAGAGTGGCTGGGT

GGCTGGAGCCATAGGCATGGAGTTGCCAGTACCTACCGCTCTGTGCACACTTCCCGTCAGTGCCGCGGGGCTGGATCGAGCTTGGCTGCCCACAAGGCTA

CTTGAGAGGAGGCCTCTGCAAGGTCGCTGCTTCAGCCACCTGCCTACTCTACAGGGCGCCTTAGAATATTGGTAATGAAGGAATCCCCCAGTAGAGAAGG

TGTGGGCCTCCTGCCATGTCTGAGGGCAAGAGGCTCAAGTTAGGGAAGACTGGACCTAAGAGAGCTGAGGTGGGCCAGTGAGATGCCTCAGCAAGGAAAG

GTGCTTAACAGAGGCCTGCGTTGGCTCCCAGGACCCATATGGTGGAGGAGAGAATTGCTGCAAGTTGTCCTGATTTCCTCACATGCACCCAGACCCAATA

AACAAATAAATGTATTACTTTTT
Translation
MGVSAEPRSLSVAGAGLASPVIEKARSALLQSQDVEDTVETLM - UNI19249 - LHPVIKAFLCGSISGTCSTLLFQPLDLLKTRLQALQPSDLG -

 UNI19955 - GPRRVGMLAVFLKVVRTESLLGLWKGMSP SIVRCVPGVGIYFGTLYSSKQYFLRGHPPTALESVILGMGSRSVAGVCMSPITVIKTR

YE SGTYSYESIYAALRSIYCSEGHRGLFRGLTATLLRDAPFSGLYLMFYSQTRTAVLHGTA - UNI6269 - AQLDAALIPLINFSCGIFAGVLASL

VTQPADVIKTHMQLSPVKFQWIGQAATLIFK NHGLRGFFHGSVPRALRRTLMAAMAWTVYEEMMARMGLKS

For any suggestions or comments, please send an email to unitrap@crg.es