Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032526 (Deb1)
Chromosomal location
Chr 9: 121619516 - 121622039 (+)
Description
differentially expressed in B16F10 1 Gene [Source:MGI Symbol;Acc:MGI:1349474]
RefSeq_dna
NM_026794 
RefSeq_peptide
NP_081070.1 
UniGene
Mm.24848 Mm.475294 
MGI
MGI:1349474 
Uniprot/SWISSPROT
Q9D174 
Uniprot/SPTREMBL
Q8BVH6 
Human Ortholog
ENSG00000008324 (SS18L2)
Omim not available
UniTrap UNI30472
Vector Insertion
Chr 9: 121619834 - 121621682
Public Clones CMHD-GT_296C2-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035113
Sequence
GCAGCATGTCTGTCATCTTCGCTCCTGACTGGCTACGCGGCAAAGCCAAGGTCAATCAAGAGACAATCCAGCGG CTCCTGGAGGAGAATGACCAGCTGA

TCCGCTGTATCGTGGAGTATCAGAATAAGGGCCGAGCGAACGAGTGCGTCCA - UNI30472 - GTATCAGCATGTGTTACATAGAAATCTCATTTAT

TTAGCTACCATCGCAGACGCCAACACAAGCAGTCTCACAAAGGCAGTGGAGTAGTTTTCCAGAAGGCTGTAATGAGGACTGATTGGAACCCATCTCCTGG

GAATCAGAGAGCTGCTCAGAACATGGGCAAAAAGTCCCATTCATTTTAGACTGTGAAGAAACTCGCTACCAACTCTACTGTATTCTGACTATAAATATTT

ATTAATAAAACAGATCCCACGGTAGAACCTGAGGACCTGCGAGGACCTGAGGTGTATGACAGCGGTGTCATTGTCAACAATAGTGATTATCTGATGACAT

GTAATAAATGATACACGTCCGTC
Translation
MSVIFAPDWLRGKAKVNQETIQR LLEENDQLIRCIVEYQNKGRANECVQ - UNI30472 - QYQHVLHRNLIYLATIADANTSSLTKAVE
Transcript ENSMUST00000068330
Sequence
CAAGGTCAATCAAGAGACAATCCAGCGGGTGAGCGACCGAGAGCCGGAGATTTGGTGCAGGAGCTTCCTGCAGGGGCCGGACCGTGGTGGGGACAGCCTG

TGGGCCGGGGAAGGAATGGGAGCAGGGTCAGCTCGGCGCCTGCCCCGGACCTCCAGCTGAGAGCCCCCTGCATTTCTTCCTCGCCCGTCTTTCAGCTCCT

GGAGGAGAATGACCAGCTGATCCGCTGTATCGTGGAGTATCAGAATAAGGGCCGAGCGAACGAGTGCGTCCA - UNI30472 - GTATCAGCATGTGT

TACATAGAAATCTCATTTATTTAGCTACCATCGCAGACGCCAACACAAGCAGTCTCACAAAGGCAGTGGAGTAGTTTTCCAGAAGGCTGTAATGAGGACT

GATTGGAACCCATCTCCTGGGAATCAGAGAGCTGCTCAGAACATGGGCAAAAAGTCCCATTCATTTTAGACTGTGAAGAAACTCGCTACCAACTCTACTG

TATTCTGACTATAAATATTTATTAATAAAACAGATCCCACGGTAGAACCTGAGGACCTGCGAGGACCTGAGGTGTATGACAGCGGTGTCATTGTCAACAA

TAGTGATTATCTGATGACATGTAATAAATGATACACGTCCGTC
Translation
QGQSRDNPAGERPRAGDLVQELPAGAGPWWGQPVGRGRNGSRVSSAPAPDLQLRAPCISSSPVFQLLEENDQLIRCIVEYQNKGRANECVQ - UNI304

72 - QYQHVLHRNLIYLATIADANTSSLTKAVE

For any suggestions or comments, please send an email to unitrap@crg.es