Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032534 (AL450317.13)
Chromosomal location
Chr 9: 102488908 - 102528454 (-)
Description
centrosomal protein 63  [Source:RefSeq peptide;Acc:NP_001074591]
RefSeq_dna
NM_001081122 
RefSeq_peptide
NP_001074591.1 
Uniprot/SPTREMBL
Q80ZM0 Q3UPP8 
Human Ortholog
ENSG00000182923 (CEP63)
Omim not available
UniTrap UNI36924
Vector Insertion
Chr 9: 102525885 - 102528455
Public Clones (sanger) 5SD134G05 (ggtc) 3SD062B03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14654
Vector Insertion
Chr 9: 102521140 - 102522091
Public Clones FHCRC-GT-S3-12C1 (fhcrc)
Private Clones OST456563 (lexicon) OST274456 (lexicon) OST273776 (lexicon) OST273717 (lexicon)
OST84318 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26127
Vector Insertion
Chr 9: 102517604 - 102517701
Public Clones not available
Private Clones OST135781 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27955
Vector Insertion
Chr 9: 102509770 - 102515624
Public Clones not available
Private Clones OST43410 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20988
Vector Insertion
Chr 9: 102489343 - 102491037
Public Clones not available
Private Clones OST346525 (lexicon) OST82794 (lexicon)
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000016523
Sequence
AACCGACCGCATGCCCCAAAGACGGGCGAGCTGCGGCTAACTGTGGTGCGGTCTCGGCCCTGGCCACGGTGGTGCCGCTAGGCTCCAGGCCTCATGGCCC

GCGGCCGCAGCTCGTTGCGGCCCACCTGCCGCGGGGCTTTCCAATGCCGGGTTGCGGCTGCCCGGTCGTCGCGCCCCTGGGTTCCTCCTCCTCCCTATGG

GACTCTGGGCTGGCCGGCCAG ACTACAGCAATGAATTGGTGGCCTAGCAACCTCCAAAG ATGGAAAAGCCGAAGTTCGAGGACACAGAGCTG - UNI

14654 - TTGCCAAAACAAAGAGGATTTAGAGATGGAGGCTTTGTTGGAAGGAATACAAAATCGGGGGCATAGTGG - UNI14654 - GGGATTTTT

GACATCCTGTGAAGCAGAACTGCAAGAGCTCATGAAACAGATCGATATAATGGTGGCTCATAAGAAGTCGGAGTGGGAGGGGCAGACGCACGCTCTGGAG

ACTTGCTTGGACATCCGTGATCGGGAGCTGAAGGCTCTGAGGAGTCAGCTGGACATGAAGCACAAAGAG - UNI14654 - - UNI26127 - GTTG

GAATATTGCATCAGCAGATAGAAGAACATGAGAAAACCAAGCAAGAAATGGCCATGGAGTACAAGGAGGAGTTACTGAAGCTGCAGGAGGAA - UNI26

127 - TTAAGCAGACTGAAGAGAAGCTATGAAAAGCTGCAGAAAAAGCAACTAAGAGAATTTAGAGGAAATACCAAAAGTTTTCGAGAGGATCGGTCTG

AGATTGAGAGGCTAACTGGAAAAATAGAG - UNI27955 - GAATTCCGACAGAAGTCTCTGGACTGGGAGAAGCAGCGTCTGATTTATCAGCAACAG

GTATCTTCTCTGGAAGCACAGAGGAAGGCTCTGGCTGAACAGTCGGAGATAATCCAG GCTCAGCTTGCCAACCGGAAACAGAAATTAGAGTCCGTGGAA

CTATCTAGCCAGTCAGAAATTCAACACCTGAACAGTAAGCTTGAGCGGGCTAAGGACACCATCTGTGCCAATGAGCTGGAAATAGAGCGCCTTAACATAA

GGGTCAACGACCTGATGGGAACCAATATGACTATCCTGCAGGACCATCGGCAGAAGGAGGAGAAACTAAGGGAATCTGAGAAGTTACTAGAG GCTCTGC

AGGAAGAACAGAAAGAGTTGAAGGCAAGTCTTCAATCTCAAGAAACCTTCATCCTTGAGGCAAAAATGCAGGAGAAACTGCAAACGACATTAAAGGCAGT

TGGCACTCAGCAGTCCGTAGAAAG GCCTCTGGAGGACTGTCAGAAGGAAAGGAAGTACAGCTCTCCAGGGCAAGGAGTCTTGGATAATGTGCTCTCCCA

GCTGGACTTCAGCCACAGCAGTGAAGAACTCCTGCAGGCAGAGGTGACGCGTCTTGAAGGCAG TTTAGAATCTGTGAGTGCAACATGCAAACAGCTGAG

CCAAGAACTAATGGAAAAATACGAAGAGCTGAAGAGGATGGAAGGGCATAACAATGAGTACCGGACAGAGATAAAGAAG TTGAAGGAACAGATTCTGCA

GGCTGATCAGACCTACAGTTCTGCCCTGGAAGGAATGAAGATGGAAATCTCCCAGCTAACTCGGGAGTTGCACCAGCGAGATATCACTATTGCTTCTGCC

AAGTGTTCCTCCTCAGACATGGAAAAGCAGCTGAAGGCAGAGATGCAGAAGGCAGAAGAAAAGGCTGTAGAGCATAAG GAGATTCTAAGTCAGCTGGAA

TCTCTCAAATTAGAAAATCATCGTCTTTCTGAAACAGTGATGAAGCTGGAACTGGGCTTGCATGAG - UNI20988 - GGCTCGCTGCCCACCTCTCC

TCTGGGATCGATAGCTACCAGGTTTCTGGAAGAGGAGGAGCTGAGGTCTCACCATATTCTAGAGCGCCTGGACGCCCACATTGAAGAACTGAAAAGAGAG

AGTGAGAAGACGGTGAGGCAGTTCACAGCCCTCGTGTAGCCCTGCACAGCCACAGACGGAAGACTGGATTATAAAGTTGTAATGAAGCAATGCTCGCAAG

GGCGGCACTGAGGAGTCTGCAGACTGGGCACTTGGGTATTTTCACTGCGTTGTGTGGAGGACTGCTTCCATAGGAACTTGTGAGAATAAACCGCTTTGCA

GACTTTTCTCACATGAATGTTTATTACCACAGAGCAATGCTTTCTCTTTCCGACTTACATGTGAATAGCTGTGTACTACTGAAAATAAAGATTGTACTAT

ACAGTTTGAAACTAG
Translation
   - UNI14654 -  - UNI14654 -  - UNI14654 - - UNI26127 -  - UNI26127 -  - UNI27955 -  MTILQDHRQKEEKL

RESEKLLE ALQEEQKELKASLQSQETFILEAKMQEKLQTTLKAVGTQQSVER RPLEDCQKERKYSSPGQGVLDNVLSQLDFSHSSEELLQAEVTRLEG

S SLESVSATCKQLSQELMEKYEELKRMEGHNNEYRTEIKK LKEQILQADQTYSSALEGMKMEISQLTRELHQRDITIASAKCSSSDMEKQLKAEMQKA

EEKAVEHK EILSQLESLKLENHRLSETVMKLELGLHE - UNI20988 - GSLPTSPLGSIATRFLEEEELRSHHILERLDAHIEELKRESEKTVRQF

TALV
Transcript ENSMUST00000093791
Sequence
AACCGACCGCATGCCCCAAAGACGGGCGAGCTGCGGCTAACTGTGGTGCGGTCTCGGCCCTGGCCACGGTGGTGCCGCTAGGCTCCAGGCCTCATGGCCC

GCGGCCGCAGCTCGTTGCGGCCCACCTGCCGCGGGGCTTTCCAATGCCGGGTTGCGGCTGCCCGGTCGTCGCGCCCCTGGGTTCCTCCTCCTCCCTATGG

GACTCTGGGCTGGCCGGCCAG ACTACAGCAATGAATTGGTGGCCTAGCAACCTCCAAAG ATGGAAAAGCCGAAGTTCGAGGACACAGAGCTG - UNI

14654 - TTGCCAAAACAAAGAGGATTTAGAGATGGAGGCTTTGTTGGAAGGAATACAAAATCGGGGGCATAGTGG - UNI14654 - GGGATTTTT

GACATCCTGTGAAGCAGAACTGCAAGAGCTCATGAAACAGATCGATATAATGGTGGCTCATAAGAAGTCGGAGTGGGAGGGGCAGACGCACGCTCTGGAG

ACTTGCTTGGACATCCGTGATCGGGAGCTGAAGGCTCTGAGGAGTCAGCTGGACATGAAGCACAAAGAG - UNI14654 - - UNI26127 - GTTG

GAATATTGCATCAGCAGATAGAAGAACATGAGAAAACCAAGCAAGAAATGGCCATGGAGTACAAGGAGGAGTTACTGAAGCTGCAGGAGGAA - UNI26

127 - TTAAGCAGACTGAAGAGAAGCTATGAAAAGCTGCAGAAAAAGCAACTAAGAGAATTTAGAGGAAATACCAAAAGTTTTCGAGAGGATCGGTCTG

AGATTGAGAGGCTAACTGGAAAAATAGAG - UNI27955 - GAATTCCGACAGAAGTCTCTGGACTGGGAGAAGCAGCGTCTGATTTATCAGCAACAG

GTATCTTCTCTGGAAGCACAGAGGAAGGCTCTGGCTGAACAGTCGGAGATAATCCAG GCTCAGCTTGCCAACCGGAAACAGAAATTAGAGTCCGTGGAA

CTATCTAGCCAGTCAGAAATTCAACACCTGAACAGTAAGCTTGAGCGGGCTAAGGACACCATCTGTGCCAATGAGCTGGAAATAGAGCGCCTTAACATAA

GGGTCAACGACCTGATGGGAACCAATATGACTATCCTGCAGGACCATCGGCAGAAGGAGGAGAAACTAAGGGAATCTGAGAAGTTACTAGAG GCTCTGC

AGGAAGAACAGAAAGAGTTGAAGGCAAGTCTTCAATCTCAAGAAACCTTCATCCTTGAGGCAAAAATGCAGGAGAAACTGCAAACGACATTAAAGGCAGT

TGGCACTCAGCAGTCCGTAGAAAG GCCTCTGGAGGACTGTCAGAAGGAAAGGAAGTACAGCTCTCCAGGGCAAGGAGTCTTGGATAATGTGCTCTCCCA

GCTGGACTTCAGCCACAGCAGTGAAGAACTCCTGCAGGCAGAGGTGACGCGTCTTGAAGGCAG TTTAGAATCTGTGAGTGCAACATGCAAACAGCTGAG

CCAAGAACTAATGGAAAAATACGAAGAGCTGAAGAGGATGGAAGGGCATAACAATGAGTACCGGACAGAGATAAAGAAG TTGAAGGAACAGATTCTGCA

GGCTGATCAGACCTACAGTTCTGCCCTGGAAGGAATGAAGATGGAAATCTCCCAGCTAACTCGGGAGTTGCACCAGCGAGATATCACTATTGCTTCTGCC

AAGTGTTCCTCCTCAGACATGGAAAAGCAGCTGAAGGCAGAGATGCAGAAGGCAGAAGAAAAGGCTGTAGAGCATAAG GAGATTCTAAGTCAGCTGGAA

TCTCTCAAATTAGAAAATCATCGTCTTTCTGAAACAGTGATGAAGCTGGAACTGGGCTTGCATGAG GCAAAAGAGATTTCACTAGCAGACCTTCAGGAG

AATTATATTGAGGCCTTAAATAAATTAGTGTCTGAAAATCAACAACTGCAGAAAGATTTGATGAGCACCAAATCTGAGCTGGAGCATGCTACTAACATGT

GCAAAAAAAAAGATGGCGAGATCTTTAACCCAGCACACAGCAGAGCTGCCGGGTTCAAGAATGCAGAGCTTAA GCCAATCCATGGCCAGCACAGACATG

ACGGAATAAAGACCGAGCAGTACAAAACAGGTCACCACTCGCCTCGAGGACAAACGTTGGATAGCATAGACCCTGTGGCCAGGGGTCCCAGCCCCCTGAG

TTCTCACATCAGCCCCGGCAGCTCCACCGTCTCTCTGCCTTCCAACTTTCTATTTGAGGCTCACTCTTTGCCTTCAGTGCTAGATATAAATGATGTCAAC

TTTTCTGACAGTCTGTCTGACTGTATGAATGACCAAGAAGAGTTTGTATCTTCG - UNI20988 - GGCTCGCTGCCCACCTCTCCTCTGGGATCGAT

AGCTACCAGGTTTCTGGAAGAGGAGGAGCTGAGGTCTCACCATATTCTAGAGCGCCTGGACGCCCACATTGAAGAACTGAAAAGAGAGAGTGAGAAGACG

GTGAGGCAGTTCACAGCCCTCGTGTAGCCCTGCACAGCCACAGACGGAAGACTGGATTATAAAGTTGTAATGAAGCAATGCTCGCAAGGGCGGCACTGAG

GAGTCTGCAGACTGGGCACTTGGGTATTTTCACTGCGTTGTGTGGAGGACTGCTTCCATAGGAACTTGTGAGAATAAACCGCTTTGCAGACTTTTCTCAC

ATGAATGTTTATTACCACAGAGCAATGCTTTCTCTTTCCGACTTACATGTGAATAGCTGTGTACTACTGAAAATAAAGATTGTACTATACAGTTTGAAAC

TAG
Translation
MPGCGCPVVAPLGSSSSLWDSGLAGQ TTAMNWWPSNLQR RWKSRSSRTQSC - UNI14654 - CCQNKEDLEMEALLEGIQNRGHSG - UNI146

54 - GGFLTSCEAELQELMKQIDIMVAHKKSEWEGQTHALETCLDIRDRELKALRSQLDMKHKE - UNI14654 - - UNI26127 - VGILHQQI

EEHEKTKQEMAMEYKEELLKLQEE - UNI26127 - LSRLKRSYEKLQKKQLREFRGNTKSFREDRSEIERLTGKIE - UNI27955 - EFRQKSL

DWEKQRLIYQQQVSSLEAQRKALAEQSEIIQ AQLANRKQKLESVELSSQSEIQHLNSKLERAKDTICANELEIERLNIRVNDLMGTNMTILQDHRQKEE

KLRESEKLLE ALQEEQKELKASLQSQETFILEAKMQEKLQTTLKAVGTQQSVER RPLEDCQKERKYSSPGQGVLDNVLSQLDFSHSSEELLQAEVTRL

EGS SLESVSATCKQLSQELMEKYEELKRMEGHNNEYRTEIKK LKEQILQADQTYSSALEGMKMEISQLTRELHQRDITIASAKCSSSDMEKQLKAEMQ

KAEEKAVEHK EILSQLESLKLENHRLSETVMKLELGLHE AKEISLADLQENYIEALNKLVSENQQLQKDLMSTKSELEHATNMCKKKDGEIFNPAHSR

AAGFKNAELK KPIHGQHRHDGIKTEQYKTGHHSPRGQTLDSIDPVARGPSPLSSHISPGSSTVSLPSNFLFEAHSLPSVLDINDVNFSDSLSDCMNDQE

EFVSS - UNI20988 - GSLPTSPLGSIATRFLEEEELRSHHILERLDAHIEELKRESEKTVRQFTALV

For any suggestions or comments, please send an email to unitrap@crg.es