Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032537 (Ephb1)
Chromosomal location
Chr 9: 101824491 - 102257022 (-)
Description
Eph receptor B1 Gene [Source:MGI (curated);Acc:Ephb1-001]
RefSeq_dna
NM_173447 
RefSeq_peptide
NP_775623.2 
MGI
MGI:1096337 
Uniprot/SWISSPROT
Q8CBF3 
Uniprot/SPTREMBL
B1B1C2 Q8CA63 B1B1C1 
Human Ortholog
ENSG00000154928 (EPHB1)
Omim not available
UniTrap UNI30305
Vector Insertion
Chr 9: 101969200 - 102097786
Public Clones D024F11 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000085169
Sequence
AGTCTGGCCCGCTCTGTCCTCCCGTAGGCTCCGCTGTAGCTCGCAATGTGACACCAGGACGCACACGCTCTCGCGCGCTCTCCCAGGCTCGCTCTCCCTC

ACCCTCTCTCACACACGCACGCACACACCCACCTCTCCCATAAACACACACACACACATGCACACCCACATCCACGCGCGCCCGCACCGCCCCACGCGCG

CACACTCCCGCCCACGCCCACGCCGCGCTCCGGGGAGTCCGGTCCCGGCCAGAGCGCGAAAGGACACGGAGAAGCCACCCGCCGGGAGCGCAGCGGCGCC

CTGGGACGCGGCGCGTCTCCGCTGGGGCTCGGCCTGGGGGCCGCTGGCCGGCGATGGCCCTGGATTGCTTGCTGCTCTTCCTCCTGGCATCTGCAGTGGC

CGCGATGGAAG AGACATTGATGGACACAAGGACAGCCACTGCAGAGTTGGGATGGACGGCCAACCCTGCCTCTGGG - UNI30305 - TGGGAAGAA

GTCAGTGGCTATGATGAAAACCTGAACACCATCCGTACTTACCAAGTGTGCAACGTCTTCGAACCCAACCAGAACAACTGGCTGCTTACCACCTTTATCA

ACAGAAGGGGCGCCCATCGCATCTATACAGAGATGCGCTTCACTGTGAGGGACTGCAGCAGCCTTCCAAATGTCCCAGGCTCCTGCAAGGAGACCTTCAA

CTTGTACTACTATGAGACTGACTCTGTGATTGCCACCAAGAAGTCAGCCTTCTGGTCTGAAGCCCCCTACCTCAAAGTGGACACCATTGCTGCAGATGAG

AGCTTCTCCCAGGTGGATTTTGGGGGAAGGTTGATGAAAGTCAACACGGAAGTCAGGAGCTTTGGGCCTCTTACTAGGAACGGTTTTTACCTCGCTTTCC

AGGATTATGGAGCCTGTATGTCTCTCCTTTCTGTCCGTGTCTTCTTCAAAAAGTGTCCCAGCATCGTGCAGAATTTTGCAGTGTTCCCAGAAACCATGAC

AGGAGCAGAGAGCACATCTCTGGTGATTGCTCGGGGCACATGCATCCCAAATGCGGAAGAAGTGGATGTGCCCATAAAACTCTACTGCAACGGAGATGGA

GAGTGGATGGTGCCCATTGGGCGCTGTACCTGTAAGCCTGGCTATGAGCCTGAGAACAGCGTGGCCTGCAAGG - UNI30305 - CCTGTCCTGCGGG

GACCTTCAAGGCCAGCCAGGAAGCTGAAGGCTGCTCCCACTGCCCCTCCAACAGTCGCTCCCCTTCAGAGGCGTCTCCCATCTGCACCTGCCGGACTGGC

TATTACCGAGCTGACTTTGATCCACCAGAGGTGGCGTGTACTA - UNI30305 - GTGTCCCATCGGGTCCTCGAAATGTCATCTCCATCGTGAATGA

GACATCTATCATTCTAGAGTGGCACCCTCCAAGAGAGACTGGTGGGAGAGATGACGTGACGTACAACATCATCTGCAAGAAGTGCCGAGCAGACCGCCGC

AGCTGCTCCCGCTGCGATGACAATGTGGAGTTTGTCCCCAGGCAACTGGGCTTGACTGAGTGTCGTGTCTCCATCAGTAGCCTATGGGCCCACACCCCGT

ACACCTTTGATATCCAGGCCATCAATGGAGTCTCTAGCAAGAGTCCCTTTCCCCCACAGCACGTCTCTGTCAACATCACCACAAACCAAGCTG CCCCCT

CCACTGTTCCTATCATGCACCAGGTCAGTGCCACCATGAGGAGCATCACCTTGTCATGGCCTCAGCCGGAGCAACCCAATGGCATAATCCTGGACTATGA

GATCCGGTACTATGAGAAG GAACACAATGAGTTCAACTCTTCCATGGCCAGGAGCCAGACCAACACAGCACGTATCGATGGGCTACGGCCTGGCATGGT

ATACGTGGTCCAGGTGCGAGCTCGAACCGTGGCTGGCTATGGCAAGTTCAGTGGCAAGATGTGTTTCCAGACTCTGACAGATG ATGATTACAAGTCGGA

GCTGAGAGAGCAGCTACCCCTGATTGCTGGCTCGGCAGCAGCTGGAGTCGTATTTGTTGTGTCTCTGGTGGCCATCTCTATTGTCTGCAGCAG GAAACG

AGCTTACAGCAAAGAGGCTGCGTACAGTGATAAGCTTCAACATTACAGCACAGGCCGAG GGGAGTTCGGCGAGGTGTACAAGGGCCGTTTGAAGCTGCC

AGGCAAGAGGGAAATCTATGTGGCCATCAAGACCCTGAAGGCTGGGTACTCAGAGAAACAGCGTCGGGATTTTCTGAGCGAGGCGAGCATCATGGGCCAG

TTTGACCATCCCAACATCATTCGCCTGGAGGGTGTCGTCACCAAGAGCCGGCCTGTCATGATCATTACGGAGTTCATGGAGAACGGCGCTTTAGACTCTT

TCCTCCGG CAAAATGATGGACAGTTCACCGTGATCCAGCTTGTGGGGATGCTGAGGGGCATCGCTGCTGGCATGAAGTACCTATCTGAGATGAATTATG

TGCACCGGGACCTGGCTGCTAGAAACATTCTGGTCAACAGCAACCTGGTGTGCAAAGTTTCTGACTTTGGTCTCTCTCGCTACCTCCAGGATGACACCTC

AGACCCCACCTACACCAGCTCCTTG GGAGGGAAGATCCCTGTGAGATGGACAGCTCCAGAGGCCATCGCCTACCGCAAGTTTACGTCAGCCAGCGATGT

CTGGAGCTATGGGATTGTCATGTGGGAAGTGATGTCATTTGGAGAGAGACCTTACTGGGATATGTCCAATCAAGAT GTCATCAATGCCATTGAGCAGGA

TTACCGGCTGCCTCCTCCTATGGACTGCCCAGCTGCCCTGCACCAGCTCATGCTGGACTGTTGGCAGAAGGATCGCAATAGCCGGCCCCGTTTTGCAGAG

ATCGTCAACACCCTGGACAAGATGATCCGGAACCCAGCTAGTCTCAAGACTGTGGCAACCATCACCGCTGT GCCTTCCCAACCCCTGCTTGACCGCTCT

ATCCCAGACTTCACGGCCTTTACCACCGTGGATGACTGGCTAAGTGCCATCAAAATGGTCCAGTACAGGGACAGCTTCCTCACCGCAGGCTTCACCTCCC

TTCAGCTGGTCACCCAGATGACATCAGA AGACCTCCTGAGAATAGGGGTAACCTTGGCAGGCCATCAGAAGAAGATTCTGAGTAGCATTCACTCAATGA

GGGTCCAGATGAACCAGTCACCATCGGTAATGGCGTGAGAACTCGGTGTTCATAGGGGAGGAGAGGAATGTAAAGGACCAGGGTCAAAGGGGAGCCAGAG

GTTGACCACTGTGGAATGTGCCAGAAAGATCAGCTTCTTGGCTGAGAAACAACTTCCCATCTGTGAAGAATGAACTGGACTTGTTGCCCACGGGCAACCG

CCGTTTCTCGGCAACGGAAGTCCGTAGATGCCACGGGAAACCAAACACGTAATGATAAAGACAGAGAAAGGTGATGCTAAACAGAAGCAAATCTGAAACC

GTATGCATTGGGGACCAAGGTGAACTCGGTTCCCATCTGAGAGGGACTGGAGTTACCTGTCTGCAGGAAGAAAGGAAGGAGGTGGAAGGGAAGAGACCGA

AGCCCCAGCTGTGCCATGCTCTCCCTCACCAATGACATTCTTTTCTTTTCTCCTTTCTTACTCCTCCCTCAGAGCCCCTCCTCCCTCCCCCACATCCATC

TCCCTTTGCTCATGACTCATGTAGGGAAGTTTCTTCAAATAAAGCCCAGCTCCTGAGTCTCCAGATGTCGTCTGTCAGTTGCCAAAGGACTTTGCTGACC

ACTACTGCATGGGGATCCAACCAATTCAATTAATGTCTTCATATTGAAGAAGAGATGTACCTTCAATTGAAAACCTTGTTTTTCTTTTGTTTGCATTTTC

TGCAAAAAGGAAAAAAAAAAAGAAACCACAAATTGGAAAAAAAATAGAAAAACCTGTTTCCGTGTGCAAACGCACACGTATGTGTGTCTGCGTTATAAAA

TGACTGTGCTTGTTCGTGACAGATGCAAACAAGAAAAAAGAATTGGGAAAGGTTTTTGGCCCTGGGAGGTCTCAAGGGGCTGGAATATGCTGTTGGCCTG

GCTCTCTGCTTGGCCCGCTGGGAAGAGAAAAGGGGGAGGGATGATCGTAAATGAAAGAAAAAAAAGTCTCTGAAGAGTTTGCAAATTAAGACAGGAAACA

GGTGAGTGGTTTGAATTGGGTGCAGAGTGGGCCGGTCCAGAATGATGCTGACTGAAGAGGTATTCTTTGATAAGATCTGAAGAAAAGAAGAGGGAAAGGG

TTTCTGGAGAGTGTTCCTCATCCCAGAACCAGCGATTTGAGAGGCGCTGGCGAGGGAGAACTCTTTCTTGCCTGGCCCGTGGACTGGCTGAAGCCGTGTG

GCATGGAGGAAAGTCTCTGTCCTATCTGTGTTTCTCTTTGCATCCCTTCCTGAAACCTCATTGTTCATTGTTTGATTCGCTTTTGTAAATTCCACCTAAC

ATTGAAATATTTTTAATTTCTCCTTTTACCTTAAATCCTCTTGCTAATTTTATCTGTCTAATT
Translation
MALDCLLLFLLASAVAAMEE ETLMDTRTATAELGWTANPASG - UNI30305 - WEEVSGYDENLNTIRTYQVCNVFEPNQNNWLLTTFINRRGAHR

IYTEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSVIATKKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDYGACM

SLLSVRVFFKKCPSIVQNFAVFPETMTGAESTSLVIARGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPENSVACKA - UNI30305 - A

CPAGTFKASQEAEGCSHCPSNSRSPSEASPICTCRTGYYRADFDPPEVACTS - UNI30305 - SVPSGPRNVISIVNETSIILEWHPPRETGGRDDV

TYNIICKKCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSSKSPFPPQHVSVNITTNQAA APSTVPIMHQVSATMRSITL

SWPQPEQPNGIILDYEIRYYEK EHNEFNSSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTDD DDYKSELREQLPLIAGSAAAG

VVFVVSLVAISIVCSR RKRAYSKEAAYSDKLQHYSTGRG GEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGV

VTKSRPVMIITEFMENGALDSFLR QNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSL GG

KIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQD VINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIR

NPASLKTVATITAV VPSQPLLDRSIPDFTAFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSE EDLLRIGVTLAGHQKKILSSIHSMRVQMNQS

PSVMA
Transcript ENSMUST00000035129
Sequence
AGTCTGGCCCGCTCTGTCCTCCCGTAGGCTCCGCTGTAGCTCGCAATGTGACACCAGGACGCACACGCTCTCGCGCGCTCTCCCAGGCTCGCTCTCCCTC

ACCCTCTCTCACACACGCACGCACACACCCACCTCTCCCATAAACACACACACACACATGCACACCCACATCCACGCGCGCCCGCACCGCCCCACGCGCG

CACACTCCCGCCCACGCCCACGCCGCGCTCCGGGGAGTCCGGTCCCGGCCAGAGCGCGAAAGGACACGGAGAAGCCACCCGCCGGGAGCGCAGCGGCGCC

CTGGGACGCGGCGCGTCTCCGCTGGGGCTCGGCCTGGGGGCCGCTGGCCGGCGATGGCCCTGGATTGCTTGCTGCTCTTCCTCCTGGCATCTGCAGTGGC

CGCGATGGAAG AGACATTGATGGACACAAGGACAGCCACTGCAGAGTTGGGATGGACGGCCAACCCTGCCTCTGGG - UNI30305 - TGGGAAGAA

GTCAGTGGCTATGATGAAAACCTGAACACCATCCGTACTTACCAAGTGTGCAACGTCTTCGAACCCAACCAGAACAACTGGCTGCTTACCACCTTTATCA

ACAGAAGGGGCGCCCATCGCATCTATACAGAGATGCGCTTCACTGTGAGGGACTGCAGCAGCCTTCCAAATGTCCCAGGCTCCTGCAAGGAGACCTTCAA

CTTGTACTACTATGAGACTGACTCTGTGATTGCCACCAAGAAGTCAGCCTTCTGGTCTGAAGCCCCCTACCTCAAAGTGGACACCATTGCTGCAGATGAG

AGCTTCTCCCAGGTGGATTTTGGGGGAAGGTTGATGAAAGTCAACACGGAAGTCAGGAGCTTTGGGCCTCTTACTAGGAACGGTTTTTACCTCGCTTTCC

AGGATTATGGAGCCTGTATGTCTCTCCTTTCTGTCCGTGTCTTCTTCAAAAAGTGTCCCAGCATCGTGCAGAATTTTGCAGTGTTCCCAGAAACCATGAC

AGGAGCAGAGAGCACATCTCTGGTGATTGCTCGGGGCACATGCATCCCAAATGCGGAAGAAGTGGATGTGCCCATAAAACTCTACTGCAACGGAGATGGA

GAGTGGATGGTGCCCATTGGGCGCTGTACCTGTAAGCCTGGCTATGAGCCTGAGAACAGCGTGGCCTGCAAGG - UNI30305 - CCTGTCCTGCGGG

GACCTTCAAGGCCAGCCAGGAAGCTGAAGGCTGCTCCCACTGCCCCTCCAACAGTCGCTCCCCTTCAGAGGCGTCTCCCATCTGCACCTGCCGGACTGGC

TATTACCGAGCTGACTTTGATCCACCAGAGGTGGCGTGTACTA - UNI30305 - GTGTCCCATCGGGTCCTCGAAATGTCATCTCCATCGTGAATGA

GACATCTATCATTCTAGAGTGGCACCCTCCAAGAGAGACTGGTGGGAGAGATGACGTGACGTACAACATCATCTGCAAGAAGTGCCGAGCAGACCGCCGC

AGCTGCTCCCGCTGCGATGACAATGTGGAGTTTGTCCCCAGGCAACTGGGCTTGACTGAGTGTCGTGTCTCCATCAGTAGCCTATGGGCCCACACCCCGT

ACACCTTTGATATCCAGGCCATCAATGGAGTCTCTAGCAAGAGTCCCTTTCCCCCACAGCACGTCTCTGTCAACATCACCACAAACCAAGCTG CCCCCT

CCACTGTTCCTATCATGCACCAGGTCAGTGCCACCATGAGGAGCATCACCTTGTCATGGCCTCAGCCGGAGCAACCCAATGGCATAATCCTGGACTATGA

GATCCGGTACTATGAGAAG GAACACAATGAGTTCAACTCTTCCATGGCCAGGAGCCAGACCAACACAGCACGTATCGATGGGCTACGGCCTGGCATGGT

ATACGTGGTCCAGGTGCGAGCTCGAACCGTGGCTGGCTATGGCAAGTTCAGTGGCAAGATGTGTTTCCAGACTCTGACAGATG ATGATTACAAGTCGGA

GCTGAGAGAGCAGCTACCCCTGATTGCTGGCTCGGCAGCAGCTGGAGTCGTATTTGTTGTGTCTCTGGTGGCCATCTCTATTGTCTGCAGCAG GAAACG

AGCTTACAGCAAAGAGGCTGCGTACAGTGATAAGCTTCAACATTACAGCACAGGCCGAG GCTCCCCAGGGATGAAGATCTACATTGACCCATTCACTTA

TGAGGACCCCAATGAAGCCGTCCGGGAATTTGCCAAGGAGATTGATGTATCTTTTGTGAAAATTGAAGAGGTCATCGGAGCAG GGGAGTTCGGCGAGGT

GTACAAGGGCCGTTTGAAGCTGCCAGGCAAGAGGGAAATCTATGTGGCCATCAAGACCCTGAAGGCTGGGTACTCAGAGAAACAGCGTCGGGATTTTCTG

AGCGAGGCGAGCATCATGGGCCAGTTTGACCATCCCAACATCATTCGCCTGGAGGGTGTCGTCACCAAGAGCCGGCCTGTCATGATCATTACGGAGTTCA

TGGAGAACGGCGCTTTAGACTCTTTCCTCCGG CAAAATGATGGACAGTTCACCGTGATCCAGCTTGTGGGGATGCTGAGGGGCATCGCTGCTGGCATGA

AGTACCTATCTGAGATGAATTATGTGCACCGGGACCTGGCTGCTAGAAACATTCTGGTCAACAGCAACCTGGTGTGCAAAGTTTCTGACTTTGGTCTCTC

TCGCTACCTCCAGGATGACACCTCAGACCCCACCTACACCAGCTCCTTG GGAGGGAAGATCCCTGTGAGATGGACAGCTCCAGAGGCCATCGCCTACCG

CAAGTTTACGTCAGCCAGCGATGTCTGGAGCTATGGGATTGTCATGTGGGAAGTGATGTCATTTGGAGAGAGACCTTACTGGGATATGTCCAATCAAGAT

 GTCATCAATGCCATTGAGCAGGATTACCGGCTGCCTCCTCCTATGGACTGCCCAGCTGCCCTGCACCAGCTCATGCTGGACTGTTGGCAGAAGGATCGC

AATAGCCGGCCCCGTTTTGCAGAGATCGTCAACACCCTGGACAAGATGATCCGGAACCCAGCTAGTCTCAAGACTGTGGCAACCATCACCGCTGT GCCT

TCCCAACCCCTGCTTGACCGCTCTATCCCAGACTTCACGGCCTTTACCACCGTGGATGACTGGCTAAGTGCCATCAAAATGGTCCAGTACAGGGACAGCT

TCCTCACCGCAGGCTTCACCTCCCTTCAGCTGGTCACCCAGATGACATCAGA AGACCTCCTGAGAATAGGGGTAACCTTGGCAGGCCATCAGAAGAAGA

TTCTGAGTAGCATTCACTCAATGAGGGTCCAGATGAACCAGTCACCATCGGTAATGGCGTGAGAACTCGGTGTTCATAGGGGAGGAGAGGAATGTAAAGG

ACCAGGGTCAAAGGGGAGCCAGAGGTTGACCACTGTGGAATGTGCCAGAAAGATCAGCTTCTTGGCTGAGAAACAACTTCCCATCTGTGAAGAATGAACT

GGACTTGTTGCCCACGGGCAACCGCCGTTTCTCGGCAACGGAAGTCCGTAGATGCCACGGGAAACCAAACACGTAATGATAAAGACAGAGAAAGGTGATG

CTAAACAGAAGCAAATCTGAAACCGTATGCATTGGGGACCAAGGTGAACTCGGTTCCCATCTGAGAGGGACTGGAGTTACCTGTCTGCAGGAAGAAAGGA

AGGAGGTGGAAGGGAAGAGACCGAAGCCCCAGCTGTGCCATGCTCTCCCTCACCAATGACATTCTTTTCTTTTCTCCTTTCTTACTCCTCCCTCAGAGCC

CCTCCTCCCTCCCCCACATCCATCTCCCTTTGCTCATGACTCATGTAGGGAAGTTTCTTCAAATAAAGCCCAGCTCCTGAGTCTCCAGATGTCGTCTGTC

AGTTGCCAAAGGACTTTGCTGACCACTACTGCATGGGGATCCAACCAATTCAATTAATGTCTTCATATTGAAGAAGAGATGTACCTTCAATTGAAAACCT

TGTTTTTCTTTTGTTTGCATTTTCTGCAAAAAGGAAAAAAAAAAAGAAACCACAAATTGGAAAAAAAATAGAAAAACCTGTTTCCGTGTGCAAACGCACA

CGTATGTGTGTCTGCGTTATAAAATGACTGTGCTTGTTCGTGACAGATGCAAACAAGAAAAAAGAATTGGGAAAGGTTTTTGGCCCTGGGAGGTCTCAAG

GGGCTGGAATATGCTGTTGGCCTGGCTCTCTGCTTGGCCCGCTGGGAAGAGAAAAGGGGGAGGGATGATCGTAAATGAAAGAAAAAAAAGTCTCTGAAGA

GTTTGCAAATTAAGACAGGAAACAGGTGAGTGGTTTGAATTGGGTGCAGAGTGGGCCGGTCCAGAATGATGCTGACTGAAGAGGTATTCTTTGATAAGAT

CTGAAGAAAAGAAGAGGGAAAGGGTTTCTGGAGAGTGTTCCTCATCCCAGAACCAGCGATTTGAGAGGCGCTGGCGAGGGAGAACTCTTTCTTGCCTGGC

CCGTGGACTGGCTGAAGCCGTGTGGCATGGAGGAAAGTCTCTGTCCTATCTGTGTTTCTCTTTGCATCCCTTCCTGAAACCTCATTGTTCATTGTTTGAT

TCGCTTTTGTAAATTCCACCTAACATTGAAATATTTTTAATTTCTCCTTTTACCTTAAATCCTCTTGCTAATTTTATCTGTCTAATT
Translation
MALDCLLLFLLASAVAAMEE ETLMDTRTATAELGWTANPASG - UNI30305 - WEEVSGYDENLNTIRTYQVCNVFEPNQNNWLLTTFINRRGAHR

IYTEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSVIATKKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDYGACM

SLLSVRVFFKKCPSIVQNFAVFPETMTGAESTSLVIARGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPENSVACKA - UNI30305 - A

CPAGTFKASQEAEGCSHCPSNSRSPSEASPICTCRTGYYRADFDPPEVACTS - UNI30305 - SVPSGPRNVISIVNETSIILEWHPPRETGGRDDV

TYNIICKKCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSSKSPFPPQHVSVNITTNQAA APSTVPIMHQVSATMRSITL

SWPQPEQPNGIILDYEIRYYEK EHNEFNSSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTDD DDYKSELREQLPLIAGSAAAG

VVFVVSLVAISIVCSR RKRAYSKEAAYSDKLQHYSTGRG GSPGMKIYIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAG GEFGEVYKGRLKLPGK

REIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLR QNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVH

RDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSL GGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQD VINAIEQD

YRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITAV VPSQPLLDRSIPDFTAFTTVDDWLSAIKMVQYRDSFLTAGFT

SLQLVTQMTSE EDLLRIGVTLAGHQKKILSSIHSMRVQMNQSPSVMA

For any suggestions or comments, please send an email to unitrap@crg.es