Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032547 (Ryk)
Chromosomal location
Chr 9: 102737250 - 102810637 (+)
Description
receptor-like tyrosine kinase Gene [Source:MGI Symbol;Acc:MGI:101766]
RefSeq_dna
NM_013649 
RefSeq_peptide
NP_001036072.1 NP_038677.3 
UniGene
Mm.335391 Mm.398937 Mm.404722 
MGI
MGI:101766 
Uniprot/SWISSPROT
Q01887 
Uniprot/SPTREMBL
Q71UK0 Q8K272 
Human Ortholog
ENSG00000163785 (RYK)
Omim not available
UniTrap UNI20943
Vector Insertion
Chr 9: 102737570 - 102764203
Public Clones not available
Private Clones OST347742 (lexicon) OST347703 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19321
Vector Insertion
Chr 9: 102788459 - 102790799
Public Clones not available
Private Clones OST395330 (lexicon)
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34441
Vector Insertion
Chr 9: 102793616 - 102799531
Public Clones IST10195A10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035142
Sequence
CCCGTTCCCGGGCGGCGGGTCTGAAGCGGCGGCGCGATGAGCTGGCCGGCCGCCCCCGGCTCGGGGCTGTGAGGCGCTCGGGGCCGGGGTGCGCGGCGGC

GCGGCGGGCGGCGGACGCTCCTGCTCGGCGGCGGCCATGCGCGCGGGCCGGGGCGGCGTCCCGGGGAGCGGCGGCCTGAGGGCCCCGCCGCCGCCGCTGC

TGCTGCTGCTGCTGGCGATGCTGCCCGCCGCCGCCCCGCGGTCCCCGGCCCTGGCCGCCGCTCCTGCGGGACCCAGCGTGAGCCTCTACCTGAGCGAGGA

CGAGGTGCGCCGGCTGCTTG - UNI20943 - GTCTTGATGCAGAGCTTTACTATGTGAGAAATGACCTCATCAGTCACTACGCTCTGTCCTTTAACC

TGCTAGTGCCCAGTGAGACAAACTTCCTGCACTTCACTTGGCATGCAAAGTCCAAG GTTGAATATAAGCTGGGATTCCAAGTAGACAACTTTGTGGCTA

TGGGCATGCCCCAGGTCAATATTTCTGCTCAAGGGGAGGTCCCACGCACTTTATCAG TGTTTCGGGTCGAGCTTTCTTGTACCGGCAAAGTCGACTCTG

AAGTCATGATTCTAATGCAGCTCAATCTGACAGTGAATTCCTCAAAAAATTTTACAGTTTTAAATTTTAAACGAAGGAAAATGTGCTACAAAA AACTTG

AAGAAGTAAAAACTTCAGCCTTGGACAAAAACACTAGCAGAACTATTT ATGACCCTGTCCATGCAGCGCCAACGACTTCCACGCGTGTGTTTTACATCA

GTGTAGGGGTTTGCTGTGCAGTGATATTTCTTGTAGCAATAATATTAGCCGTTTTGCACCTTCATAGCATGAAAAGGATTGAACTGGATGACAG CATCA

GCGCCAGCAGTAGTTCCCAGGGGCTGTCTCAGCCGTCTACCCAGACGACCCAGTATCTGAGAGCTGACACACCCAACAATGCAACGCCTATCACCA GCT

CCTCAGGTTATCCTACCTTGCGGATAGAGAAGAACGACTTGCGAAGTGTCACTCTTCTGGAAGCCAAAGCCAAGGTGAAGGATATCGCAATATCCAGAGA

AAGGATCACACTGAAAGATGTCCTCCAAGAAG - UNI19321 - GTACTTTTGGGCGTATTTTCCATGGGATTTTAGTAGATGAAAAAGATCCAAATA

AAGAGAAGCAAACATTTGTAAAAACAGTTAAAG ACCAAGCATCTGAAGTTCAGGTGACGATGATGCTCACCGAGAGCTGCAAGCTTCGAGGTCTGCACC

ACAG - UNI34441 - AAACCTCCTTCCTATTACTCATGTGTGCATAGAAGAAGGAGAAAAGCCCATGGTGGTATTGCCATACATGAATTGGGGGAAT

CTTAAATTATTTCTTCGGCAGTGCAAATTAGTAGAAGCCAATAATCCACAG GCAATTTCCCAGCAAGATCTGGTCCATATGGCTATTCAGATTGCCTGC

GGGATGAGCTACCTGGCGAGGAGAGAAGTGATCCATAGAGACCTGGCTGCTAGGAACTGTGT CATCGACGACACTCTTCAAGTCAAGATCACAGACAAT

GCCCTTTCCAGAGACTTGTTTCCTATGGACTACCACTGCCTAGGGGACAACGAGAACAGGCCAGTGAGATGGATGGCTCTGGAAAGTCTGGTTAATAATG

AGTTCTCTAGTGCTAGTGACGTG TGGGCCTTTGGAGTGACGCTGTGGGAGCTCATGACTCTGGGCCAGACGCCCTACGTGGACATCGACCCCTTTGAGA

TGGCCGCTTACCTGAAAGATGGTTACCGAATAGCCCAGCCAATCAACTGCCCTGATGAACT GTTTGCTGTGATGGCCTGTTGCTGGGCCTTGGACCCTG

AGGAGAGGCCTAAGTTCCAGCAGCTGGTCCAGTGCCTCACAGAGTTCCACGCTGCCCTGGGAGCCTACGTCTGACTTCTCTCCCAGCTCCGCCACTCAGA

AGAAAGTGCCTGTCTGTCACGGATGCCCCTCGTGCAGCGCAGTGCCTGCAGGGGCACACTGTCTCCAGATCACCCAGCCTTAGCAGTGCTTCCAAACCTC

AGCTTTTAACGATGACGTAATAACGCAGAGTGTTTTCTAGATACCACTTTTACTAGGTTGAACCAAAAGGGGTTTTGTACATTTTTTGGCCAAAAATTTT

TTTAAAATATAGTGACTTTGGACTAGGGGGTGCATTCTTTTAAAAAATGAATAAACAGTTTTAAAAATTATTTAGACACAGATATTTGGAATAGCTGTCT

TAGTGCCAACTGCTTTTATTCTTAATGTTTTACTTCATTGAAGTAATGTAGGTGACTCACCTTTAAAGCTATTTTAATATTTTGGTCACTACTTTTGGGA

GTGGTTTGTCTTCAAAATGCGGTACTTTTCTTAGGAAAAACAACATTACGAAGTTGTCTGGTTTGCCTTATACGAAGAAAGATAGTATATTAGGAAAATT

GAAAAAGTAAAAAGAAAAAGAAATTACAAAGTAAAAATAAAAAAAAAAAAACATATCGCCCCCGCATGGAAAATCGCTTGTTTAGTGACCATGGCTCTGC

TCACATTTGGGGAAGCAGGTCTGAGTTCACATCTCAGTCAGCTTTCCTGTGAGCTGGAAGAAGGCTGGGGCAGGCTTGTGGAAAACAGTGGTGACCTTAT

TTATTTTTGCTCTCCGGGGAAGGAGAGGACACAGTTCCTGACAGTGACCCCTCTCTACTGCTGCGGTTCCCTCTGTGCACGCCTGGGCGGAGCTACGCAC

AGAGCCGGTGCTTCTGTTGTTGTGGGTTTGGGGGGTTTTAGTTTTGGTTTTTGGTTTAAATTGGTAATTTTTATGCTTATCTTCAAGGCTGGCTTAAGTA

TAAATTTGTTTTTTTAAAACACTTGAAAAATTAAAGGACTCATTTTATATGCTGGTATTCAAAATACTGCTCACAGTGTGTGACTGTTGGTCGTGTCCTG

AAAGTCTTGGAGTCACATTTTATCCCCTGAGAGTTTGACTCAGGTTCCAAAACCCTAACAGAAGAACAGCTGACTCTGCTCAGCCGCCAGGGCCTGTTAA

GAAGTTGGAGTTACTCCTACAAGGACTTATCATGGAGAGAGTCCACAAATACATGTATGTAGTTACACACAGGTTTGGTCTACCTAAGGGATTGTCACCT

GGGCCTGTGAAGTGACTGGGCCTGCAGCTACTGCCTCTGTGTCTGTCCTCTCAGGGATGTGAGGGAGAACATGGGTCTGTTCTATTAAAATAAGTCTTGT

GAATAAAGAGAGTATCTGAA
Translation
MRAGRGGVPGSGGLRAPPPPLLLLLLAMLPAAAPRSPALAAAPAGPSVSLYLSEDEVRRLLG - UNI20943 - GLDAELYYVRNDLISHYALSFNLL

VPSETNFLHFTWHAKSK VEYKLGFQVDNFVAMGMPQVNISAQGEVPRTLSV VFRVELSCTGKVDSEVMILMQLNLTVNSSKNFTVLNFKRRKMCYKK 

KLEEVKTSALDKNTSRTIY YDPVHAAPTTSTRVFYISVGVCCAVIFLVAIILAVLHLHSMKRIELDDS SISASSSSQGLSQPSTQTTQYLRADTPNNA

TPITS SSSGYPTLRIEKNDLRSVTLLEAKAKVKDIAISRERITLKDVLQEG - UNI19321 - GTFGRIFHGILVDEKDPNKEKQTFVKTVKD DQA

SEVQVTMMLTESCKLRGLHHR - UNI34441 - RNLLPITHVCIEEGEKPMVVLPYMNWGNLKLFLRQCKLVEANNPQ AISQQDLVHMAIQIACGMS

YLARREVIHRDLAARNCV VIDDTLQVKITDNALSRDLFPMDYHCLGDNENRPVRWMALESLVNNEFSSASDV WAFGVTLWELMTLGQTPYVDIDPFEM

AAYLKDGYRIAQPINCPDEL LFAVMACCWALDPEERPKFQQLVQCLTEFHAALGAYV

For any suggestions or comments, please send an email to unitrap@crg.es