Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032553 (Srprb)
Chromosomal location
Chr 9: 103091420 - 103104437 (-)
Description
signal recognition particle receptor, B subunit Gene [Source:MGI Symbol;Acc:MGI:102964]
RefSeq_dna
NM_009275 
RefSeq_peptide
NP_033301.1 
MGI
MGI:102964 
Uniprot/SWISSPROT
P47758 
Uniprot/SPTREMBL
Q542X6 
Human Ortholog
ENSG00000144867 (SRPRB)
Omim not available
UniTrap UNI1880
Vector Insertion
Chr 9: 103101197 - 103103616
Public Clones AY0799 (sanger)
Private Clones OST419361 (lexicon) OST42133 (lexicon)
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2005
Vector Insertion
Chr 9: 103094680 - 103099867
Public Clones BA0069 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12345
Vector Insertion
Chr 9: 103093454 - 103094542
Public Clones W086E05 (ggtc) W085B04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035157
Sequence
CTAGAGCCACGTAACTTTGGCGGCCCGGGAAGACTACACACCTCTTTCATGGCTTCGGCGAACACCCGGCGAGTTGGCGATGGCGCCGGTGGCGCCTTCC

AGCCTTACCTCGACTCCTTACGACAGGAGCTGCAGCAGAGGGATCCGACGCTGCTCTCCGTGGCGGTGGCTCTCCTGGCGGTGCTGCTGACGCTGG TGT

TCTGGAAGTTCATCTGGAGCCGAAAGAGCAGTCAGAGAGCTGTTCTCTTCGTTGGTCTCTGTGACTCTGGGAAAACGTTGCTGTTTGTCAGG - UNI18

80 - TTGCTAACTGGCCAGTACAGAGACACACAGACTTCCATTACCGATAGTTCTGCCATATACAAAGTCAACAATAACAGG GGTAACAGCCTGACTC

TGATCGACCTCCCCGGGCATGAGAGCTTGAGGTTTCAGCTCTTAGATCGCTTTAAGTCTTCAGCTAG - UNI2005 - GGCTGTGGTGTTTGTGGTGG

ACAGTGCGGCGTTCCAGCGGGAGGTGAAAGATGTGGCCGAATTTCTGTACCAGGTCCTCATCGACAGCATGGCTCTGAAGAACTCACCGTCCTTATTAAT

AGCCTGCAATAAGCAAG - UNI12345 - ATATCGCAATGGCAAAATCAGCGAAGTTGATCCAGCAGCAGCTTGAGAAGGAGCT CAACACCTTACGA

GTCACCCGGTCCGCGGCTCCCAGCACACTGGACAGTTCCAGCACCGCACCTGCTCAGTTGGGGAAGAAAGGCAAAGAATTTGAATTTTCCCAGTTGCCAC

TCAAAGTGGAGTTCCTGGAGTGTAGTGCCAAGGGTGGACGAGGGGACACTGGCTCTGCTGACATCCAGGACTTGGAGAAGTGGCTGGCCAAGATTGCCTG

AGGAGCATCGCTGGCCACAAGCGTTGGTCATGTGAGACTGACCCTGCAGTTTGAGAAAGGGCGGTGGTGGTGTGGACTGATAAAGAGGGGGCATGTCGTT

GAAGCATTTCTTGAGTTCTTGAAACAATTGTACCACCCCCACCCCACCCCCGTCAGCTCCTTTCTCAGCTAGTCCTTTCTTAATTCCCATATTCTTTCTC

CCTTTGCTAGGTGTTAGGTGTAGCATCATGTTAGTGTGAGACATAACAGAGAGGGCATCGCTTTGAGAGTAGGGTCGCATCTGAGAAGTCCTTGTCTCCT

GCCTCTGTGTTGGTCCCTTTTCCTGGGACCAGATCTGCCTGCTTGTGGAATAAGTGAACTTGCAGTTGCCCCTGGTGTAGGCATAATACAGTGTCAGTTC

TTAGTGGAGTCTGGGGTGTGAAGGTCTACAGTGAAGACAGCTTCAAAGCCACAGGCACAGCTGACAGTGTGTCCTTCACGGGCTCAGTGACCATCCCACA

CCACCCTAGCTGACAGTGTGTCCTTCACGGGCTCGGTGACCATCCCACACCACCCTAGCTGACAGTGTGTCCTTCACGGGCTCGGTGACCATCCCACACC

ACCCTAGCTGACAGTGTGTCCTTCACAGGCTCGGTGACCATCCCACACCACCCTAGCTGACAGTGTGTCCTTCATGGGCTCGGTGACCATCCCACACCAC

CCTAGCTGACAGTGTGTCCTTCACGGGCTCGGTGACCATCCCCACACCACCCTAGGTTCAAAAGCTGCCGCAACCCCGAAGAGTCACCCTCACAAGGTGG

CTCTAGGAGCCAAATCCCCAGACACTCCTAGGTTAGTGTTCTAGAGGCTCCACTGGGGAGAGCAGGGAGACAGCACACTGCTGCCTCGGGCGTGCGTGAG

CCCAGGCTGTCCCCTGTGCTACTTGATCAGCTCCTGTTGTGTCACCCCAGCTAGAGTGCTATGGAACAATACAAACTGAAGATGTCCACTGTGCATTTTA

AATACATATTTATTCATGATGCTTTAAAAAATGTTACCTTTTTAAAGTGATGCTGTCTTCAACATTTGTGTTCTCATTGCTTTTATAAATGACTGGTATC

TTGATAAATGACTATACTG
Translation
MASANTRRVGDGAGGAFQPYLDSLRQELQQRDPTLLSVAVALLAVLLTLV VFWKFIWSRKSSQRAVLFVGLCDSGKTLLFVR - UNI1880 - LLTG

QYRDTQTSITDSSAIYKVNNNR GNSLTLIDLPGHESLRFQLLDRFKSSAR - UNI2005 - RAVVFVVDSAAFQREVKDVAEFLYQVLIDSMALKNS

PSLLIACNKQD - UNI12345 - DIAMAKSAKLIQQQLEKEL LNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDT

GSADIQDLEKWLAKIA

For any suggestions or comments, please send an email to unitrap@crg.es