Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032555 (Topbp1)
Chromosomal location
Chr 9: 103207545 - 103252762 (+)
Description
topoisomerase (DNA) II binding protein 1 Gene [Source:MGI Symbol;Acc:MGI:1920018]
RefSeq_dna
NM_176979 
RefSeq_peptide
NP_795953.2 
UniGene
Mm.259893 Mm.413317 
MGI
MGI:1920018 
Uniprot/SWISSPROT
Q6ZQF0 
Human Ortholog
ENSG00000163781 (TOPBP1)
Omim not available
UniTrap UNI23173
Vector Insertion
Chr 9: 103207702 - 103208426
Public Clones (sanger) IST14645B12 (tigm)
Private Clones OST273890 (lexicon) OST109327 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23187
Vector Insertion
Chr 9: 103208518 - 103211074
Public Clones not available
Private Clones OST272779 (lexicon) OST252816 (lexicon) OST245667 (lexicon) OST204346 (lexicon)
OST157686 (lexicon) OST35305 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25196
Vector Insertion
Chr 9: 103211210 - 103212146
Public Clones not available
Private Clones OST192161 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10689
Vector Insertion
Chr 9: 103214006 - 103215101
Public Clones A038D04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18348
Vector Insertion
Chr 9: 103217561 - 103220316
Public Clones PSTVU01.HN11 (vanderbilt)
Private Clones OST425127 (lexicon)
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI515
Vector Insertion
Chr 9: 103220484 - 103222498
Public Clones AZ0197 (sanger) CF0629 (sanger)
Private Clones OST198670 (lexicon)
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14953
Vector Insertion
Chr 9: 103228184 - 103230736
Public Clones PST13457-NR (escells) PST9587-NR (escells) PST8546-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7668
Vector Insertion
Chr 9: 103231024 - 103235014
Public Clones RRS046 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32303
Vector Insertion
Chr 9: 103236510 - 103238141
Public Clones IST12450D11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9804
Vector Insertion
Chr 9: 103238497 - 103240509
Public Clones RRC071 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035164
Sequence
CGGTCTTGGCCCTTCCGGGTTCTGCAGCGTTAGCTTCGGGTTGGGGGCGCCGCCGAGGGCGGGGGCTGCGCGCCGGGCTGGCGCCCGACCCCAGCCGCCG

TCCTGCCGGCCGCGCGCCCCCCGACTTGGTGCCCGTGGGCCCTCGGGCTCCACCTAG - UNI23173 - TTCAGCTATGTCCAGAAATGACCAAGAGC

CGTTTCTTGTGAAGTTTTTAAAGTCTTCGGACAATTCAGAATGCTTTTTTAAAGCTCTTGAG - UNI23187 - TCAATAAAGGAATTACAATCAGAA

GATTATCTTCAGATTATTACAGATGAGGAAGCATTGAAGATAAGAGAGAATGACAAATCGCTTTATATCTGTGACCGTTTCAGTGGCACTGTTTTTGATC

ACCTTAAACAG - UNI25196 - CTTGGCTGCAGGATTGTTGGTCCTCAAGTGGTCACATTTTGTATGCGCCACCAGCAATGTGTCCCAAGAGCTGAG

CATCCAGTCTACAACATGATAATGTCTGACGTAACTGTATCCTGTACAAGCCTGGATAAAGACAAACGG GAAGAAGTTCATAAATACGTACAAATGATG

GGTGGACGAGTATACAGAGACCTTAATGTATCAGTCACTCACCTTATTGCAGGAGAAGTTGGGAGCAAAAAGTACTTAGTTGCTGCTAATCTGAAGAAGC

CTATTTTGCTACCTTCTTGGATAAAAACCCTTTGGGAGAAGTCACAAGAAAA - UNI10689 - AAAAATAACCAAGTACACTGATGTAAACATGGAA

GACTTTAAGTGTCCTATTTTTCTTGGTTGCATTATCTGTGTGACTGGCTTAAATGGAATACACAGAAAGACAGTCCAGCAACTCACGGCTAAGCACGGAG

GCCAGTACATGGGACAGTTGAAGATGAATGAGTGTACACACCTCATTGTGCAAGAACCAAAAG GACAAAAATACGAATGTGCCAGGAGATGGAATGTGC

ACTGTGTGACCCTGCAATGGTTTCATGACAGTATTGAGAAAGGCTTTTGTCAGGATGAATCTATATACAAGGCTGAAACCAGAGTAGAAGCAAAGATGGT

GCCTGATACTTCAACACCCACTGCTCAGAGCAATGCTGAAA - UNI18348 - GTCACACGCTCGCAGATGTCAGCCATATATCCAACATAAATGGCA

GCTGTGTAAATGAAACAATGTTTGGTTCAACTACTAGCAAACTTGAATGTTCCCTTGAAAACCTAGAAAATCTGGACATCAGTATGTTTCAAGCTCCTGA

AGACTTATTAGATGGCTGTCGG - UNI515 - ATATATCTTTGTGGTTTTAGTGGCAGAAAGCTGGATAAGCTGAGAAGGCTTATTAACAGTGGAGGT

GGAGTTCGATTTAATCAACTAAATGAAGATGTAACTCATGTAATTGTGGGAGATTATGATGACGACGTGAGGCAGTTCTGGAGCAAATCATCTCACAG G

CCTCACGTAGTGGGAGCAAAGTGGTTGCTGGAGTGTTTTACTAAAGGATATATACTTCCTGAAGAGTCCTATATCCACACTAACTACCAGCCAGCTGGAA

TTGCAGTTTCCGATCAGCCTGGAAACCAGACAGCTGTCTTAGACAAGAGCGGCTCATTCTCCAAGAGCGCCCTTGTTCCTGCTGAGAGGCTTCAGCAGGC

CGACGAGGATCTGCTTGCTCAGTATGGAAATGACGACTCCACGATGG TTGAAGCTAAGCTATCTGAAGCTTTAGAGCCTGAAGTCGGGCCTTGCCCTGG

TTCTGCTCACCGTGAGCCCTGTGATGATTCCACTCACATTTCTGTGCAAGAGGAAAACAAGTCGTCTGTCAGTCATTGCATCCTTGATGACTCTACAGTT

CGTGAAGAAGGCTTATTTAGCCAGAAGAGTTTCCTTGTTTTGGGTTTTAGTGTTGAAAATAAATGTAATATTGTAGACATCATAAGAGAGCATGCTGGCA

AGATTGTGTCCCTTCCCAGCAGAATTGTTGCTGACTATGCTGTGGTTCCACTGCTGGGATGTGAGGTAGACGTGACGGTGGGAGAAGTTGTTACAAACAC

GTGGCTG GTTACGTGTATAGACAACCAGACATTAGTTGATCCCAAGTCGAATCCCCTCTTCACACCAGTCTCAGTAATGTCGGGAGTGACTCCTTTAGA

GGACTGTGTGATTTCCTTCAGTCAGTGTGTGGGAGCAGAAAGAGATTCCTTGGTATTCTTAGCAAATCACCTTGGAGCAAG TGTTCAAGAATTCTTTGT

TCGCAAAGCCAATGCAAAGAAAGGCATGCTCGCCAGCACACATCTTATAGTGAAGGAACCGACTGGTTCCAAATACGAAGCTGCAAAGAAATGGAGTTTG

CCGGCAGTTAACATTTCATGGCTCTTAGAAACTGCGAGAATCGGGAAGAGAGCAGATGAAAACCATTTTCTGGTTGACAACGCACCTAAACAAG - UNI

14953 - AACAAGTTTTAGAAACTAAGATACCAAATGGAGTGAGTTCAAATCCAGATTTACCAGCACATCCTGACGCACACTTGGAAATTCACAGAAAA

AAGGCGGTTACACCTTTGGACATGAATCGCTTTCAGAGTAGAGCCTTCCGTGCTGTCATTTCACAGCAGAGGGGGCAGGACCCCACCTTTCCACCAGTAC

GGCAGCCCCTTACTAAGGAGCCCTCTTTACACCTGGACACACCATCAAAGTTTCTGTCCAAGGACAAGCTTTTCAAGCCATCCTTTGATGTGACG - UN

I7668 - GATGCACTTGCAGCCCTGGAAACCCCAAATGCTGCCAGCCAGAAGCGGAAACTAAGCTCACCACTCTCTGAAGTCATCGTCAGAAACCTGAC

AGTTGCTTTGGCAAATAGTTCCCGAAACACTGACAGTCATTCTGCCAGCCCTCAGCTGAAGGGTGCCCATTTGGAGGAG GAAGAGACTCGGAAACCACT

TGACAGCGTTGTGGTGTGTGTGAGTAAGAAGCTCAGTAAGAAGCAGAGTGAGCTCAATGGGGTCGCAGCATCACTGGGAGCAGAGTACAG GTGGAGTTT

CGATGAGACTGTTACTCATTTCATTTACCAGGGTCGGGCAAATGACAGTAATCGAGAATATAAATCTGCAAAGGAAAGAGGGGTGCACATCGTGTCCGAG

CATTGGCTATTAGAG - UNI32303 - TGTGCTCAAGAGTATAAGCATCTTCCTGAATCTCTTTATCCACACACTTACAATCCCAAAATGAGTTTGGA

CATCAACACAGTGCAAGATGGGCGGCTCTGTAACAGCCGGGCACCCTTGGCAGTTTCTGCATCTAAGGATGATGGG CCAGATCATCTGTCTGTAGAAGG

AAATGAGACAAACACTATGGGCACAAATGACAAAGAGTCACCTCTGTTGAATGGGAGTGGAAGAGATGACTGTAAAGGAG - UNI9804 - CTCTGAC

CCAGGCCTTGGAGATGAGAGAGAACTTCCAGAAGCAGCTGCAAGAGATCATGTCAGCCACCTGCATTGTGAAGACGCCTGCCCAGAAGACTTGCATGTCA

AGAAGCAGCTGTAACAGCGCCTCTTCAACTCCTGACAGCGCTCGCTCTGTGCGGAGCGGACGAAGCCGAGTCCTGGAGGCACTCAG GCAGTCTCGGCAG

GCAGTGCCTGATGTGAACACGGAGCCGTCCCAGAACGAGCAGATCATTTGGGACGACCCGACAGCAAGGGAAGAGAGAGCAAGGCTTGCCAGCAACTTAC

AGTGGCCCAGCGACCCCACACAGCATTCTGAGCTTCAGGTTGAGATAAAAATGCCGGATGACTCTCCCTCTCGAAAGCCTGTGTACCATTCAGAAATTGC

TGAGCAGG CCTCGTGTGTTACTCAAGCCCCAGGGCACCCAGGCTCTGAAGAACCAGAGCCTCCAGTAGCAGAAAGGCCTTTGATCCCCGAGCCGCAAGC

CCCCGCTGTAGCTTCCCCCCTGGCTAAGCCGCCTGTGGCCCCACAACCTGCAGACAAG ATTGAAACACAGGAGGAGACGCACAGAAAAGTTAAAAAACA

GTATGTGTTCCAGATGTCGTCTCTGAATTCTCAAGAGCGGATTGATTACTGTCGCCTGATTAAAGACTTAG GTGGGTCGGTGATCGAGAAGCAGTGCTC

TGACCCCAGCTGCACACACATGGTTGTGGGCTACCCACTGCGCAATGAGAAGTACTTAGCTTCTATGGCAGCTGGTAAATGGGTGCTTCATCGCTCCTAC

CTAGACGCTTGCAAGACAGCTGGGCGCTTTGTGCAG GAAGAAGACTACGAGTGGGGAAGTAGCTCCATACTTGATGCTCTCCCTGACGTCACTGAGCAC

CAGCAGAAGCTCGCACTGGCGGCAATGAGATGGAGGAAAAGAATCCAGCAAAGTCAAGAATCCGGCATTGTTGAG GGAGCATTTAGTGGCTGGAAAGCT

ATTTTACGTGTTGATCGGCCCCGAGAAGCTGGGTTCAAACGCCTTCTTCAGGCAGGAGGAGCAAAG GTGTTATCTGGTCATCCAGAACCTTTACTTAAA

GATGCTACGCATCTCTTTTGTGACTTCAATAAACTGAAACCTGATGACTGCAGAGTTTTCATCGCAGAGGCTACTGCCCAGAACATGGTCTGCTTGAAAA

CAGAATATATCGCTGATTATCTCATGCTG GAATCCCCTCCTTGTGCAGACAATTACCGTGTATCCGAAGCTGCTTTATTCCATAATAAGAAAGGTGGGC

CTGGATTACCACAGAAGAGGAAAACTCCTGCAGAGAATGTAGTCAAACGGCCTCGAGTACACTGAAGTGAGCCATACACAACCACCCAACGAATGTTTTT

GAGTTTAGTGTGCTTGCCTAAAATGTATAAAGTGCACTAGAAAATTTTCAGCTACAACCTGAACATTGCTGTGATGCATTTGTGTAGCAGTTTAAAGGCA

TACATCTGAAGGACTATGCTTCAGATTCTAATGATCCTGTAAACTGGATACCTTTAACCTGAATTTGAATCACTGGTTATTGACTGTTCCTAATGAGGCT

GAAATAGTTTTAACAAGGAGATTTGTTTCAAAAATGTCATAGTTCATAAAAGCAAAAGTTATACATTAGGGTTATTTCATGTTTTCCTGATTTTTATATA

TGTATTCTTGCCATTTAACCTCTTTAACAGCCTGAGCAGAGAGTTTAACAATGAAGCTGGGGCTCTAAACTTAAAATATGTATATATGTAAATGTGTGTA

TGTATAAACTTCTATCATTTGCCAAACTTGGGCACCAAAACTTTGAGATAAAGAATAAAAAAAAATAGCAACTTAAACTGT
Translation
 - UNI23173 - MSRNDQEPFLVKFLKSSDNSECFFKALE - UNI23187 - SIKELQSEDYLQIITDEEALKIRENDKSLYICDRFSGTVFDHLK

Q - UNI25196 - LGCRIVGPQVVTFCMRHQQCVPRAEHPVYNMIMSDVTVSCTSLDKDKR EEVHKYVQMMGGRVYRDLNVSVTHLIAGEVGSKKYL

VAANLKKPILLPSWIKTLWEKSQEK - UNI10689 - KKITKYTDVNMEDFKCPIFLGCIICVTGLNGIHRKTVQQLTAKHGGQYMGQLKMNECTHLI

VQEPKG GQKYECARRWNVHCVTLQWFHDSIEKGFCQDESIYKAETRVEAKMVPDTSTPTAQSNAES - UNI18348 - SHTLADVSHISNINGSCVN

ETMFGSTTSKLECSLENLENLDISMFQAPEDLLDGCR - UNI515 - IYLCGFSGRKLDKLRRLINSGGGVRFNQLNEDVTHVIVGDYDDDVRQFWSK

SSHR RPHVVGAKWLLECFTKGYILPEESYIHTNYQPAGIAVSDQPGNQTAVLDKSGSFSKSALVPAERLQQADEDLLAQYGNDDSTMV VEAKLSEALE

PEVGPCPGSAHREPCDDSTHISVQEENKSSVSHCILDDSTVREEGLFSQKSFLVLGFSVENKCNIVDIIREHAGKIVSLPSRIVADYAVVPLLGCEVDVT

VGEVVTNTWL VTCIDNQTLVDPKSNPLFTPVSVMSGVTPLEDCVISFSQCVGAERDSLVFLANHLGAS SVQEFFVRKANAKKGMLASTHLIVKEPTGS

KYEAAKKWSLPAVNISWLLETARIGKRADENHFLVDNAPKQE - UNI14953 - EQVLETKIPNGVSSNPDLPAHPDAHLEIHRKKAVTPLDMNRFQS

RAFRAVISQQRGQDPTFPPVRQPLTKEPSLHLDTPSKFLSKDKLFKPSFDVT - UNI7668 - DALAALETPNAASQKRKLSSPLSEVIVRNLTVALA

NSSRNTDSHSASPQLKGAHLEE EETRKPLDSVVVCVSKKLSKKQSELNGVAASLGAEYR RWSFDETVTHFIYQGRANDSNREYKSAKERGVHIVSEHW

LLE - UNI32303 - CAQEYKHLPESLYPHTYNPKMSLDINTVQDGRLCNSRAPLAVSASKDDG PDHLSVEGNETNTMGTNDKESPLLNGSGRDDCK

GA - UNI9804 - ALTQALEMRENFQKQLQEIMSATCIVKTPAQKTCMSRSSCNSASSTPDSARSVRSGRSRVLEALR RQSRQAVPDVNTEPSQNEQ

IIWDDPTAREERARLASNLQWPSDPTQHSELQVEIKMPDDSPSRKPVYHSEIAEQA ASCVTQAPGHPGSEEPEPPVAERPLIPEPQAPAVASPLAKPPV

APQPADK IETQEETHRKVKKQYVFQMSSLNSQERIDYCRLIKDLG GGSVIEKQCSDPSCTHMVVGYPLRNEKYLASMAAGKWVLHRSYLDACKTAGRF

VQ EEDYEWGSSSILDALPDVTEHQQKLALAAMRWRKRIQQSQESGIVE GAFSGWKAILRVDRPREAGFKRLLQAGGAK VLSGHPEPLLKDATHLFCD

FNKLKPDDCRVFIAEATAQNMVCLKTEYIADYLML ESPPCADNYRVSEAALFHNKKGGPGLPQKRKTPAENVVKRPRVH

For any suggestions or comments, please send an email to unitrap@crg.es