Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032560 (Dnajc13)
Chromosomal location
Chr 9: 104053962 - 104089987 (-)
Description
DnaJ (Hsp40) homolog, subfamily C, member 13 Gene [Source:MGI Symbol;Acc:MGI:2676368]
UniGene
Mm.217256 Mm.458498 
MGI
MGI:2676368 
Uniprot/SPTREMBL
Q3UQJ7 Q3UX52 Q8CHD7 
Human Ortholog
ENSG00000138246 (DNAJC13)
Omim not available
UniTrap UNI28300
Vector Insertion
Chr 9: 104076857 - 104077976
Public Clones not available
Private Clones OST34587 (lexicon)
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4448
Vector Insertion
Chr 9: 104073145 - 104074850
Public Clones AC0192 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35987
Vector Insertion
Chr 9: 104069743 - 104073145
Public Clones IST12950D9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035170
Sequence
CTTCTGAAAGATTCCCTTGACGCTTGGAAGAAGGAAGTAGAAAAGAAGCCACCTATGATGTCCATAGACGATGCTTATGAAGTGCTTAATCTGCCTATAG

GCCAGGGGCT GCATGATGAAAGCAAGATCAGAAAAGCTTACTTTAGACTGGCACAGAAATACCACCCGGATAAGAACCCGGAAGGAAGG GACATGTTT

GAAAAAGTAAATAAAGCATATGAATTTCTATGTACCAAGTCAACAAAAATAGTGGATGGGCCAGATCCAGAGAATATAATTTTAATTCTGAAAACACAGA

GCATCCTTTTCAACCGCCATAAAGAAG AGTTACAGCCTTATAAATATGCAGGATATCCCATGCTAATTAGGACCATAACAATGGAGACTTCAGATGACC

TCCTCTTCTCAAAAGAATCACCACTGTTGCCTGCGGCTGCAGAGCTGGCTTTCCACACAGTCAACTGCTCAGCCCTCAACGCTGAAGAGCTCAGGAGAGA

GAATGGCTTAGAG GTATTACAGGAGGCATTTAGTCGCTGTGTGGCTGTCCTGAATCGCTCCAGTAAGCCAAGTGACATGTCAGTGCAG GTGTGTGGAC

ACATAAGCAGATGCTACAGTGTGGCTGCCCAGTTTGAAGAGTGCCGGGAGAAGATCACAGAAATGCCTGGCATCATCAAGGACCTCTGCCGGGTGCTGTA

TTTTGGCAAG TGTATCCCACGGGTGGCCGCCCTCGCAGTAGAATGTGTCAGCTCTTTCGCTGTGGATTTCTGGCTACAGACACATCTATTTCAGGCTGG

AATTTTGTGGTATCTGCTTGTTTATCTGTTTAACTATGACTATACATTGGAAGAGAGTGGCATTCAGAAAAATGAAGAAACAAACCAGCAG GAAGTAGC

CAACAGTCTTGCCAAACTCAGTGTCCATGCTCTGAGTCGCCTTGGTGGGTATTTGTCTGAAGACCAAGCAACCCCAGAAAATCCAACTGTAAGGAAGAGT

TTAGCTGGCATGCTGACACCCTACATTGCTCGAAAGCTAGCTGTAGCTAGTGCTACTGAG ACCCTGAAGATGCTTAACAGCAACACAGAGAGCCCGTAT

TTGATGTGGAACAACTCTACAAGGGCAGAACTGCTTGAGTTTCTTGAGTCACAACAAGAAAATATGATCAAAAAG GGTGATTGTGACAAAACTTATGGG

GCAGAATTTGTCTACAGTGAACACGCCAAAGAACTTATCGTGGGTGAGATTTTTGTTAGAGTCTATAATGAAGTCCCAACTTTCCAGCTAGAG - UNI2

8300 - GTTCCTAAAGAGTTTGCTGCAAGTCTGTTGGATTACATAGGCTCTCAGGCCCAGTACCTCCACACGTTCATGGCCATCACTCATGCTGCAAAA

GTGGAGTCGGAGCAACATGGGGACCGCTTACCAAGAGTGGAAATGGCTTTGGAGGCTCTGAGAAATGTGATCAAATACAACCCAG GTTCTGAAAGTGAA

TGCATCGGGCACTTTAAGTTAATATTTTCTCTTCTCCGAGTCCATGGAGCTGGTCAAGTGCAGCAGCTGGCGTTAGAG - UNI4448 - - UNI3598

7 - GTTGTGAATATAGTGACATCCAACCAAGACTGTGTCAATAACATTGCAGAATCCATGGTTTTGTCCAACTTATTGGCTCTTCTACACTCATTGCCA

TCGA - UNI35987 - GCCGTCAGCTTGTCCTGGAGACTCTTTATGCTTTGGCATCAAATACAAAGATAATCAAAGAAGCCATGGCAAAAG - UNI3

5987 - GAGCTTTGATTTATTTATTGGATATGTTCTGCAATTCAACACACCCTCAGGTTCGGTCCCAGACAGCTGAACTTTTTGCCAAAATGACAGCAG

ACAAACTAATAGGTCCAAAG GTGCGGATTACATTGATGAAATTTCTGCCCAGCGTGTTCATGGATGCCATGAGAGACAACCCTGAAGCTGCTGTGCATA

TATTTGAGGGAACTCACGAAAATCCAGAGCTGATCTGGAACGACAGCTCCAGAGATAAGGTTTCCACAACTGTGAGAGAGATGATGCTGGA GCACTTTA

AAAATCAACGGGACAACCCTGATGTGAACTGGAAG TTGCCTGAAGACTTTGCTGTGGTGTTCGGAGAAGCAGAGGGGGAGCTTGCTGTTGGAGGCGTTT

TCTTGAGGATCTTTATTGCACAGCCAGCTTGGGTGCTGAGGAAACCCAGAGAATTTCTTATTGCACTGCTAGAAAAATTAACTGAGCTCCTGGAGAAGAA

CAATCCACAT GGAGAAACTCTGGAAACACTGACCATGGCGACGGTCTGTCTCTTCAGTGCACAGCCTCAGTTGGCAGATCAAGTCCCGCCATTGGGCCA

TCTTCCCAAAGTTATCCAGGCGATGAATCACAGAAACAATGCCATTCCTAAGAGTGCAATTCGGGTTATTCACGTCCTGTCTGACAATGAG CTGTGTGT

CCGAGCCATGGCGTCCTTGGAGACCATTGGCCCACTGATGAATGGAATGCGAAAGCGAGCAGATACTGTGGGCCTGGCCTGTGAAGCCATCAACCGCATG

TTCCAGAAGGAGCAGAGTGAGCTGGTAGCGCAG GCATTGAAAGCAGAGTTGGTCCCATACCTCTTAAAGCTGCTTGAAGGCGTAGGCCTTGAAAACCTC

GACAGTCCTGCTGCCACCAAGGCCCAGATTGTCAAAGCTCTTAAGGCAATGACTCGAAGTCTGCAGTATGGAGAACAG GTGAGTGAAATCCTCTCTCGG

TCTTCAGTCTGGAGTGCCTTCAAAGACCAGAAACATGACTTGTTCATTTCTGACTCCCAAACAGCAGGATACCTCACAG GACCTGGAGTTGCTGGCTAC

CTTACAGCAGGTACATCCTCATCAGCCATGTCTAATCTGCCGCCTCCCGTAGACCATGAGGCAGGAGACCTTGGCTATCAGACTTGAAGCACTCAGACAG

TAAATGCTGGAAGGCCAGTACTGCGCCCACATTCCTCCAACCAACATGTTGAAACAGACTCCGCTGCCTTTCTCCTGGTTTCATGACAGTGTTATTCCTT

TTTCTATAAATAGACTTTTATTTAGGAGAAGAGTCCATGATTCTGACGTATCACGTTCTGAGAAAGCACTCTGTGGGTCAGCCACCTGGGTACACAAGAA

TTTCTTCTTCTTGATGTATGTAAGCACATTTTGTTCCTTTATATCTGTTTACAAGACTGTGAATCAAAAAGACAAACTTTCTTCCTAGTTTTTATAACTT

TTTTTTGAATTACTGTGACTGTGGGATTAAGCTGCAGTCTACAAACATTGGGCTAAATCTTATCCCAGAGCAGGGCGCCTCTCTCTCCTGCACCAGGTCT

CCATGACCGTCTTCCTCTCATCGTCCCTCCACCCGTGACCAGATCCTCAATCATTAACTCTGAGAGCTCGGTGCACATCGGTGTGTATGACAGGCGTCAC

CAAACTGAACGACAAGGAGCTTGTGCAAAAAAATTAAAACTAAAAATGGATGTGAAGATGTTATGTAAGAGATTAGTGTAATTGTGAAATGTTCTATACA

TTATCAAATATATAAAGCTTTCTATATTGAATGTACATTATACAGATCATTCATATGTGTACATAAAATTTT
Translation
LLKDSLDAWKKEVEKKPPMMSIDDAYEVLNLPIGQGL LHDESKIRKAYFRLAQKYHPDKNPEGR DMFEKVNKAYEFLCTKSTKIVDGPDPENIILILK

TQSILFNRHKEE ELQPYKYAGYPMLIRTITMETSDDLLFSKESPLLPAAAELAFHTVNCSALNAEELRRENGLE VLQEAFSRCVAVLNRSSKPSDMSV

Q VCGHISRCYSVAAQFEECREKITEMPGIIKDLCRVLYFGK CIPRVAALAVECVSSFAVDFWLQTHLFQAGILWYLLVYLFNYDYTLEESGIQKNEET

NQQ EVANSLAKLSVHALSRLGGYLSEDQATPENPTVRKSLAGMLTPYIARKLAVASATE TLKMLNSNTESPYLMWNNSTRAELLEFLESQQENMIKK 

GDCDKTYGAEFVYSEHAKELIVGEIFVRVYNEVPTFQLE - UNI28300 - VPKEFAASLLDYIGSQAQYLHTFMAITHAAKVESEQHGDRLPRVEMA

LEALRNVIKYNPG GSESECIGHFKLIFSLLRVHGAGQVQQLALE - UNI4448 - - UNI35987 - VVNIVTSNQDCVNNIAESMVLSNLLALLH

SLPSS - UNI35987 - SRQLVLETLYALASNTKIIKEAMAKG - UNI35987 - GALIYLLDMFCNSTHPQVRSQTAELFAKMTADKLIGPK VR

ITLMKFLPSVFMDAMRDNPEAAVHIFEGTHENPELIWNDSSRDKVSTTVREMMLE EHFKNQRDNPDVNWK LPEDFAVVFGEAEGELAVGGVFLRIFIA

QPAWVLRKPREFLIALLEKLTELLEKNNPH GETLETLTMATVCLFSAQPQLADQVPPLGHLPKVIQAMNHRNNAIPKSAIRVIHVLSDNE LCVRAMAS

LETIGPLMNGMRKRADTVGLACEAINRMFQKEQSELVAQ ALKAELVPYLLKLLEGVGLENLDSPAATKAQIVKALKAMTRSLQYGEQ VSEILSRSSVW

SAFKDQKHDLFISDSQTAGYLTG GPGVAGYLTAGTSSSAMSNLPPPVDHEAGDLGYQT

For any suggestions or comments, please send an email to unitrap@crg.es