Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032564 (Cpne4)
Chromosomal location
Chr 9: 104449616 - 104935266 (+)
Description
copine IV Gene [Source:MGI (curated);Acc:Cpne4-001]
RefSeq_dna
NM_028719 
RefSeq_peptide
NP_082995.1 
UniGene
Mm.442109 Mm.326240 
MGI
MGI:1921270 
Uniprot/SWISSPROT
Q8BLR2 
Uniprot/SPTREMBL
Q9D6C8 Q8CEQ2 
Human Ortholog
ENSG00000196353 (CPNE4)
Omim not available
UniTrap UNI33659
Vector Insertion
Chr 9: 104588936 - 104775008
Public Clones IST14628C4 (tigm) IST10861G3 (tigm) IST11013F5 (tigm) IST14671B8 (tigm)
IST14765F4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000077190
Sequence
CCTCTTTACTCAGCGAGTTCCTGAGCCCAGCAGCTCCTTCCACGCCGTTCACCCTCTCCCCCAGCCCCCAGCCCCCAGCCCCAAGAATGGAGTCGGGGTT

TCCAGAGCGACCAAACTCTCCTCCCAGCATCTTTATCCTCCTCGGCTGTTGCTAAACTACCCCCAGTGGACCAAAGAGGGGGGAGGGAAGCCCGACTCTC

CTAAGACCTCTTTACAACTACATCACCCAGGACCTCCACTCCAAAGGCGGATTTTGCATCCTGGGGGCGTGACAGACCTGTCCCGGGCTGAATTCTCTTT

CTAGTCTCTGAGGCTGGCACACCCAG AATGAAGAAGATGAGCAACATTTATGAGTCGGCTGCCAACACGCTGGGAATCTTTAACAGCCCCTGCCTGACC

AAAGTCGAGCTGCGTGTGGCATGCAAAGGCATTTCCGACAGAGATGCCCTGTCCAAGCCGGACCCTTGTGTCATCCTCAAGATGCAATCCCACGGGCAAT

GGTTTGAG - UNI33659 - GTGGACAGGACGGAGGTGATTCGTACCTGCATAAACCCAGTGTACTCAAAGCTGTTTACAGTGGACTTTTATTTTGAA

GAGGTCCAACGTCTCCGGTTTGAAGTTCATGACATCAGCAGCAACCACAATGGACTGAAGGAAGCTGACTTCCTTGGTGGCATGGAGTGCACACTTGGCC

AG ATTGTCTCACAGAGAAAGCTCTCCAAGTCCTTGCTGAAGCATGGGAACACAGCGGGGAAATCCTCCATCACG GTGATTGCTGAAGAATTATCGGGC

AATGACGACTATGTTGAGCTTGCATTCAATGCACGGAAATTGGATGATAAG GATTTCTTCAGTAAATCAGACCCATTTCTGGAAATTTTCAGAATGAAC

GATGACGCGACTCAACAGCTTGTGCATCGAACAGAG GTTGTGATGAATAACTTAAGCCCAGCCTGGAAGTCATTCAAAGTATCGGTAAACTCTCTATGC

AGTGGAGATCCAGACCGCAGGCTGAAG GTAGCTATAGACTTCACTGCCTCTAATGGGGACCCCAGAAACAGCTGTTCCCTGCACTATATCCACCCTTAC

CAGCCCAATGAGTACCTAAAGGCCTTGGTGGCTGTGGGAGAGATTTGCCAAGACTATGACAG TGACAAAATGTTCCCGGCTTTTGGGTTTGGCGCCAGG

ATACCCCCGGAATACACG GTCTCTCATGACTTTGCAATCAACTTTAATGAAGACAACCCGGAGTGTGCAG GAATTCAAGGAGTCGTGGAAGCCTATCA

GAGCTGTCTTCCCAAGCTCCAGCTTTATGGTCCCACCAACATCGCTCCCATCATTCAGAAGGTTGCCAAGTCAGCCTCGGAGGAGACAAACACCAAGGAA

GCATCG CAATACTTCATCCTGCTGATCCTGACAGACGGGGTCATCACAGACATGGCTGACACCCGGGAGGCCATCGTCCACGCCTCCCACCTCCCCATG

TCAGTCATCATCGTTGGGGTGGGGAACGCCGACTTCAGTGACATGCAGATGCTGGACGGTGACGACGGAATTCTAAGGTCACCCAAGGGAGAACCTGTCC

TTCGAGACATCGTCCAGTTTGTGCCCTTCCGGAACTTCAAACAT GCATCGCCAGCTGCCCTTGCCAAGAGTGTGTTGGCTGAAGTCCCAAATCAAGTCG

TAGACTATTACAATGGTAAAGGGATTAAACCAAAGTGCTCATCGGAAGTATATGAATCGTCCCGGACACTGGCACCGTGAACTACACTTTTACAGAATTC

TGAAGCACTGTTTATCTATTCCTGTACTTTAAATAAC
Translation
 MKKMSNIYESAANTLGIFNSPCLTKVELRVACKGISDRDALSKPDPCVILKMQSHGQWFE - UNI33659 - VDRTEVIRTCINPVYSKLFTVDFYF

EEVQRLRFEVHDISSNHNGLKEADFLGGMECTLGQ IVSQRKLSKSLLKHGNTAGKSSIT VIAEELSGNDDYVELAFNARKLDDK DFFSKSDPFLEIF

RMNDDATQQLVHRTE VVMNNLSPAWKSFKVSVNSLCSGDPDRRLK VAIDFTASNGDPRNSCSLHYIHPYQPNEYLKALVAVGEICQDYDS SDKMFPA

FGFGARIPPEYT VSHDFAINFNEDNPECAG GIQGVVEAYQSCLPKLQLYGPTNIAPIIQKVAKSASEETNTKEAS QYFILLILTDGVITDMADTREA

IVHASHLPMSVIIVGVGNADFSDMQMLDGDDGILRSPKGEPVLRDIVQFVPFRNFKH ASPAALAKSVLAEVPNQVVDYYNGKGIKPKCSSEVYESSRTL

AP
Transcript ENSMUST00000098443
Sequence
AAACATCTTAGTTTTGGAGTCTGGATGCTCAATCTCCATAAGCAGTTTTTGCTCCCCACTTTCATAGAACTTTAAGTTAACTTGTCTGAAATAAGGAGTA

GAAGGGGAGTTATGACAGCTGGATCTTAAGTCATGCAGACCAGACCCTCTAGCCACTCCCTATGCCCTGTAGGGTCATGAAGTAGAATAGAAAGCTTAAC

CTAACACAACAGATTAATGCATTGCTCTGGCCACAGAATTGGTTTTTTATTTGCCACATGACCAAAAGATCCAGTCAGGGTTCATGAACCACCCTTGGCA

AATTGCTTCTGCTCCTCCAATCCAGTGCTATCTGCAAACTCATAAGCCCAGCTTTAGATCCACAGCCCAGGATCTCTCTGATTGTGAGCCACCTTTGCTT

G CCCCAGTGTCCTGTCCCTTTGCATCAGGATCAATGTGACATGAACTTAGATGGAGGGAAGATCTAATTGGGTTAAATTTCAGAG CACCCCTCAGTAA

TGCCATCAGATGAACAGACTGAACAACAGATGGGGTCAGAGCCCTCGTGACCTAAATCATCTCTGGAAACAACATCATAGGCACCTTCAGAGGTGTCTTA

TCTTCTAGGACATTCATTTCCTCAGGCTGGCAAGG AGATTTTATAAGAATAAACCCGGAGTTGCCTACGGCAGCAGCCTGCACACAGACGCGCAATCCT

TGTGTCAACATCTCCCTTCATACAAAAAAGCTAAGAGCAGGACCAGACGCGATAGATCGTCCAGGTGCACAGCGATAGGAAGCTGCGACAGGAAGAGAAC

AGATGAACTTTTCAGCGCGTGCCTGAGCATTGCTTACGCCTGTTTCATCAG AATGAAGAAGATGAGCAACATTTATGAGTCGGCTGCCAACACGCTGGG

AATCTTTAACAGCCCCTGCCTGACCAAAGTCGAGCTGCGTGTGGCATGCAAAGGCATTTCCGACAGAGATGCCCTGTCCAAGCCGGACCCTTGTGTCATC

CTCAAGATGCAATCCCACGGGCAATGGTTTGAG - UNI33659 - GTGGACAGGACGGAGGTGATTCGTACCTGCATAAACCCAGTGTACTCAAAGCT

GTTTACAGTGGACTTTTATTTTGAAGAGGTCCAACGTCTCCGGTTTGAAGTTCATGACATCAGCAGCAACCACAATGGACTGAAGGAAGCTGACTTCCTT

GGTGGCATGGAGTGCACACTTGGCCAGGTAGACAGAAGATGTCTTTTGTCTCCTCCACTTCAGGCCTTCCTCCCCTCTTCTGATCCTTGCTCTCTTTTCC

TTTAGTGGTCATTTTCTTTAAACTACAGCATCTTCCAACATTTCCTAGGTACTGTTATATCAGTTATATGCACAAGAGATCATGCAAGTATATGCAGTTG

CTTCTTTTGTAGAGTTAATAAACTCTCATCCTGAATGTC
Translation
    MKKMSNIYESAANTLGIFNSPCLTKVELRVACKGISDRDALSKPDPCVILKMQSHGQWFE - UNI33659 - VDRTEVIRTCINPVYSKLFTVD

FYFEEVQRLRFEVHDISSNHNGLKEADFLGGMECTLGQVDRRCLLSPPLQAFLPSSDPCSLFL
Transcript ENSMUST00000057742
Sequence
CCTCTTTACTCAGCGAGTTCCTGAGCCCAGCAGCTCCTTCCACGCCGTTCACCCTCTCCCCCAGCCCCCAGCCCCCAGCCCCAAGAATGGAGTCGGGGTT

TCCAGAGCGACCAAACTCTCCTCCCAGCATCTTTATCCTCCTCGGCTGTTGCTAAACTACCCCCAGTGGACCAAAGAGGGGGGAGGGAAGCCCGACTCTC

CTAAGACCTCTTTACAACTACATCACCCAGGACCTCCACTCCAAAGGCGGATTTTGCATCCTGGGGGCGTGACAGACCTGTCCCGGGCTGAATTCTCTTT

CTAGTCTCTGAGGCTGGCACACCCAG AATGAAGAAGATGAGCAACATTTATGAGTCGGCTGCCAACACGCTGGGAATCTTTAACAGCCCCTGCCTGACC

AAAGTCGAGCTGCGTGTGGCATGCAAAGGCATTTCCGACAGAGATGCCCTGTCCAAGCCGGACCCTTGTGTCATCCTCAAGATGCAATCCCACGGGCAAT

GGTTTGAG - UNI33659 - GTGGACAGGACGGAGGTGATTCGTACCTGCATAAACCCAGTGTACTCAAAGCTGTTTACAGTGGACTTTTATTTTGAA

GAGGTCCAACGTCTCCGGTTTGAAGTTCATGACATCAGCAGCAACCACAATGGACTGAAGGAAGCTGACTTCCTTGGTGGCATGGAGTGCACACTTGGCC

AG ATTGTCTCACAGAGAAAGCTCTCCAAGTCCTTGCTGAAGCATGGGAACACAGCGGGGAAATCCTCCATCACG GTGATTGCTGAAGAATTATCGGGC

AATGACGACTATGTTGAGCTTGCATTCAATGCACGGAAATTGGATGATAAG GATTTCTTCAGTAAATCAGACCCATTTCTGGAAATTTTCAGAATGAAC

GATGACGCGACTCAACAGCTTGTGCATCGAACAGAG GTTGTGATGAATAACTTAAGCCCAGCCTGGAAGTCATTCAAAGTATCGGTAAACTCTCTATGC

AGTGGAGATCCAGACCGCAGGCTGAAG TGCATAGTGTGGGACTGGGACTCCAACGGCAAGCATGACTTCATCGGAGAGTTCACCTCCACCTTCAAGGAG

ATGAGAGGAGCCATGGAAGGGAAACAG GTACAGTGGGAATGCATCAACCCCAAGTACAAAGCCAAGAAGAAAAATTACAAGAACTCAGGCATGGTGATT

CTAAACCAGTGCAAG ATCCACAAGATGCATTCCTTCTTGGACTACATCATGGGCGGCTGTCAAATCCAGTTTACA GTAGCTATAGACTTCACTGCCTC

TAATGGGGACCCCAGAAACAGCTGTTCCCTGCACTATATCCACCCTTACCAGCCCAATGAGTACCTAAAGGCCTTGGTGGCTGTGGGAGAGATTTGCCAA

GACTATGACAG TGACAAAATGTTCCCGGCTTTTGGGTTTGGCGCCAGGATACCCCCGGAATACACG GTCTCTCATGACTTTGCAATCAACTTTAATGA

AGACAACCCGGAGTGTGCAG GAATTCAAGGAGTCGTGGAAGCCTATCAGAGCTGTCTTCCCAAGCTCCAGCTTTATGGTCCCACCAACATCGCTCCCAT

CATTCAGAAGGTTGCCAAGTCAGCCTCGGAGGAGACAAACACCAAGGAAGCATCG CAATACTTCATCCTGCTGATCCTGACAGACGGGGTCATCACAGA

CATGGCTGACACCCGGGAGGCCATCGTCCACGCCTCCCACCTCCCCATGTCAGTCATCATCGTTGGGGTGGGGAACGCCGACTTCAGTGACATGCAGATG

CTGGACGGTGACGACGGAATTCTAAGGTCACCCAAGGGAGAACCTGTCCTTCGAGACATCGTCCAGTTTGTGCCCTTCCGGAACTTCAAACAT GCATCG

CCAGCTGCCCTTGCCAAGAGTGTGTTGGCTGAAGTCCCAAATCAAGTCGTAGACTATTACAATGGTAAAGGGATTAAACCAAAGTGCTCATCGGAAGTAT

ATGAATCGTCCCGGACACTGGCACCGTGAACTACACTTTTACAGAATTCTGAAGCACTGTTTATCTATTCCTGTACTTTAAATAAC
Translation
 MKKMSNIYESAANTLGIFNSPCLTKVELRVACKGISDRDALSKPDPCVILKMQSHGQWFE - UNI33659 - VDRTEVIRTCINPVYSKLFTVDFYF

EEVQRLRFEVHDISSNHNGLKEADFLGGMECTLGQ IVSQRKLSKSLLKHGNTAGKSSIT VIAEELSGNDDYVELAFNARKLDDK DFFSKSDPFLEIF

RMNDDATQQLVHRTE VVMNNLSPAWKSFKVSVNSLCSGDPDRRLK CIVWDWDSNGKHDFIGEFTSTFKEMRGAMEGKQ VQWECINPKYKAKKKNYKN

SGMVILNQCK IHKMHSFLDYIMGGCQIQFT VAIDFTASNGDPRNSCSLHYIHPYQPNEYLKALVAVGEICQDYDS SDKMFPAFGFGARIPPEYT VS

HDFAINFNEDNPECAG GIQGVVEAYQSCLPKLQLYGPTNIAPIIQKVAKSASEETNTKEAS QYFILLILTDGVITDMADTREAIVHASHLPMSVIIVG

VGNADFSDMQMLDGDDGILRSPKGEPVLRDIVQFVPFRNFKH ASPAALAKSVLAEVPNQVVDYYNGKGIKPKCSSEVYESSRTLAP

For any suggestions or comments, please send an email to unitrap@crg.es