Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032565 (Nudt16)
Chromosomal location
Chr 9: 105031668 - 105034135 (-)
Description
nudix (nucleoside diphosphate linked moiety X)-type motif 16 Gene [Source:MGI Symbol;Acc:MGI:1922936]
RefSeq_dna
NM_029385 
RefSeq_peptide
NP_083661.2 
MGI
MGI:1922936 
Uniprot/SWISSPROT
Q6P3D0 
Human Ortholog
ENSG00000206369 (NUDT16P)
Omim not available
UniTrap UNI30379
Vector Insertion
Chr 9: 105032841 - 105033622
Public Clones CMHD-GT_435B12-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035179
Sequence
AGAACCCGGAAGTGCGAGCCTCGAGATGGAGGGGCATCGGAAAGTGGAGCTCAGCGAGGCCCTGGCGCTCGGGCCGGACTGGCGCCACGCCTGCCATGCG

CTGCTCTACGCGCCCGACCCCCGCAAGCTGTTCGGCCGCATCCCGATGCGCTTCGCCGTGCTG ATGCAGATGCGCTTTGACGGGCGCCTGGGCTTCCCT

GGCGGCTTCGTGGACGCGCAGGACAGCTGCCTGGAGGACGGGCTGAACCGGGAACTGCGCGAGGAGCTGGGCGAAGCGATGTCTGCCTTCCGCGTTGAAC

GCTCTGACTACCGCAGCTCACACATCGCGGCCAGACCGCGCGTGGTGGCCCACTTCTATGCCAAGCGCCTGACTCTGGAACAGCTGCAGGCTGTGGAAGC

CAGGGCACCTCAAGCCAAGGACCATGGGCTGGAG - UNI30379 - GTGCTGGGCCTGGTGCGGGTACCCCTGTACGTCCTCCGTGATGGTGAGGGAG

GCCTGCCTGCCTTTCTGGAGAATTCCTTCATTGGAGCTGCCCGAGAGCAGCTACTAGAAGCCCTTCAGGACTTGAAACTTCTGGATCCTGGCATTATTGC

AAAACTAAAGATCCCAGATTCTAAGTAGAATCGGACCAGCATGGACCCCTGGAACCCAGAGGGCCTTGGTATGAGGGAGGGAAGGACAAGTGGTCTCTCT

TTGGGGTATAAAGGATTGTAGGTGGTGCCAGATTAGCAACAGGGAAGGATATGCACTGTTTTCAACGGAACACCTTGTCTGGTGGCATTAGGGATAAAAG

GCCTTTGTAGTATCCCAGAGTCCTGCCTTATACATGGACAAACAGCCTGGAAGCTCCAGGTATGTATATGTGTAGTTCGTGGTCACACACAGCCTGACAC

ACTGTCATCTGCCCAGTTTAACCATGATGTGGCATTTGGCACATCCCACTCCTTCCGGGTAAATGGGAGGGTTTCTTCCCCATCCGCTGTAAGGCTGCTG

TCCTGTGTCCAGCCCAACCCATGCCTGTTAGGGAAGCAAAGGAGATGGCTTCTTTCTGAGAATTGTCCTGTGTTACCTGGGGCTTGAGCAGAGCAGTGGG

TTTCAGAAAGTGACGTAAGGGCCTACCCAGCCCTGCGCTCTAACTGAGAGTTGGAATTGTCAAGGGCTTCTTAGGAGGCCTGAGACCTCAGTCCTGATAC

CTGTCTTCCTGCGTGTTCATCTTTGAGCTCCCATTGTCTCTGTCTAGCCTGCCCTGCTTAAAAAAAAACAACCAAACAAACAAACCAAAAAAAAACAAAA

ACAAAAACAAAAAAAAACCTAGAGGCATCTGGAAGAGTAGGCTGATATCTGGGCCTCCAAGTTCCAGAGCTTTTTCAAAAGGTACAGGTTAATACTTGCT

CAGTGCTAGGTATGGTGACAGAAATAGAGACCCACTGCTCTTGTCTTTAAGACTTCACAGTGAGGAGTGAGCACACAGCATCATAAAGAGCACTACACAG

TAAGAAGTAGAAGCCCCTTCAGTCACATGGTGTCCGTGGGAACCCTTTACTCTGCCACGTCAAACTTATCTGCATGATGTATAAATTTGTGGTTGTTGTG

TCCCAGTAAAACACCAATTAA
Translation
MEGHRKVELSEALALGPDWRHACHALLYAPDPRKLFGRIPMRFAVL MQMRFDGRLGFPGGFVDAQDSCLEDGLNRELREELGEAMSAFRVERSDYRSSH

IAARPRVVAHFYAKRLTLEQLQAVEARAPQAKDHGLE - UNI30379 - VLGLVRVPLYVLRDGEGGLPAFLENSFIGAAREQLLEALQDLKLLDPGI

IAKLKIPDSK

For any suggestions or comments, please send an email to unitrap@crg.es