Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032570 (Atp2c1)
Chromosomal location
Chr 9: 105313693 - 105423477 (-)
Description
ATPase, Ca++-sequestering Gene [Source:MGI Symbol;Acc:MGI:1889008]
RefSeq_dna
NM_175025 
RefSeq_peptide
NP_778190.2 
UniGene
Mm.405797 Mm.411069 Mm.326247 
MGI
MGI:1889008 
Uniprot/SWISSPROT
Q80XR2 
Uniprot/SPTREMBL
Q3TTD2 Q3UWW0 Q69ZL4 Q8BMS7 Q3TVY6 Q3UZR5 
Human Ortholog
ENSG00000017260 (ATP2C1)
Omim 169600 - BENIGN CHRONIC PEMPHIGUS  
UniTrap UNI31830
Vector Insertion
Chr 9: 105372502 - 105396928
Public Clones (sanger) IST14539B9 (tigm) IST14811C5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19956
Vector Insertion
Chr 9: 105372478 - 105372502
Public Clones not available
Private Clones OST376520 (lexicon) OST334464 (lexicon) OST132152 (lexicon) OST66395 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27726
Vector Insertion
Chr 9: 105362099 - 105363346
Public Clones not available
Private Clones OST51424 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4231
Vector Insertion
Chr 9: 105338908 - 105341670
Public Clones AK0374 (sanger) XS0554 (sanger) AK0722 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2316
Vector Insertion
Chr 9: 105325440 - 105326499
Public Clones AE0323 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112557
Sequence
ATGGTGTGGATACTGTTGGCTAAG GACAGACCAGAGATTTGTTTTATGAAGGGTGCTTATGAGCAGGTGATTAAGTATTGTACTACATACAACAGCAAA

GGGCAGACTTTGGCACTTACCCAGCAGCAGAGAGATTTGTATCAACAAGAGAAGGCACGGATGGGCTCAGCGGGACTCAGAG TTCTTGCCTTGGCGTCT

GGTCCGGAACTGGGGCAGCTGACCTTCCTTGGCCTGGTCGGAATCATTGACCCTCCTAGAACTGGTGTGAAGGAAGCTGTCACAACACTCATTGCCTCAG

GAGTCTCCATCAAAATGATCACTGGAGATTCTCAGGAGACTGCAATTGCCATCG CTAGTCGTCTGGGATTGTACTCTAAGACTTCACAGTCCGTGTCTG

GGGAAGAAGTCGATACAATGGAGGTGCAGCACCTTTCACAGATAGTGCCAAAG GTTGCAGTATTTTACAGAGCAAGCCCAAGACACAAGATGAAAATTA

TTAAG - UNI2316 - TCTCTACAGAAGAACGGGGCAGTTGTAGCCATGACAGGAGATGGGGTAAATGATGCAGTTGCTCTCAAGGCTGCAGACATTG

GAGTTGCGATGGGCCAGACTGGCACCGATGTTTGCAAAGAGGCTGCAGACATGATCTTGGTGGATGATGATTTCCAAACCATCAT GTCTGCAATAGAAG

AGGGTAAAGGCATTTATAATAACATTAAAAATTTTGTTAGATTTCAACTGAGCAC GAGTATAGCAGCATTAACTTTAATCTCATTGGCTACGTTAATGA

ACTTTCCTAACCCTCTCAATGCAATGCAGATTTTGTGGATCAATATTATAATGGATGGACCCCCAGCTCAGAG CCTTGGAGTAGAGCCAGTGGATAAAG

ATGTCATTCGAAAACCGCCTCGAAACTGGAAGGACAGCATTTTGACAAAAAACTTGATACTTAAAATACTTGTTTCATCAATAATCATTGTTTGTGGGAC

TTTGTTTGTCTTCTGGCGAGAG CTTCGAGACAATGTGATAACACCCCGAGACACAACCATGACTTTCACTTGCTTTGTGTTTTTTGACATGTTCAATGC

ACTGAGTTCCAGATCTCAG ACCAAGTCTGTGTTTGAGATTGGACTCTGCAGTAATAAGATGTTCTGCTATGCAGTTCTTGGATCCATCATGGGACAGTT

GCTTGTCATTTACTTCCCTCCTCTCCAGAAGGTTTTTCAAACCGAGAGCCTGAGTATACTGG ATCTGTTGTTTCTTTTGGGCCTTACCTCGTCAGTGTG

CATTGTGTCTGAGATTATAAAGAAGGTTGAAAGGAGCCGGGAGAAGGTCCAGAAGAATGCTGGTTCAGCATCATCGTCTTTCCTTGAAGTATGATGCATA

TTGCATTTTTTTTTAATTTGCAAACTAGGAATTGCAGTCTGAGAATCATTTAGAAGGGCAAGTTCAAGAAGATAATGAAGACTTAAGGACTTTTTTAACT

TTCCATTGACTAAAAATGACCATTAATGTTAAAGACTTGATTTGAACTTTGTTGGTAGTCCCAAATGAAATTATGCAACTTTGAATAACACATTCCTTGA

TTTGAATTGGCTTTTGCAATTGAGTGAACTTCAACATATGGGCAAGTACTGAATTAAAAAATACAAAAGGCAAAACCTGAACCACCTTCTGCACTTAAAG

AATTCTAATGTACAAATACACTGTCTGTCTTAGATGGATATAAATATTTTTTTTATTTTTAAATATTGTACTATTTATGGTTGTGGGGCTTTCTTACTAA

CACACAAATAAACTCAATCATTTAAAGGCATTCTATTTGGTTTAGAAATTGCCAGGGGTGCCGTATTTCAGCTACCGTGCTTCCTTTTTCCTGAAATGTA

AGCAACTGATACCTTGTGCTACCATTTTTATATTTCAAGTTGTTTTTTTTTTTTTTTTGCACAGGATGTGACCACTGTCTAATCACTGTTCTTTTCTTTC

TTTTTGTGACTGAAAAGCATATACTGCAATTGAAGTAAATGTTTGCTCTTCTTAGTAAGTGTAAATGGTTGTTTTTTGGTTTTTTTGTAGTTTTGTTTTG

CATAGAGGAACGAGTCTTTGATCTAGCAGAATTATTAGTTCAGGGCTGTTATTGGCATTACAGTTAGAGTAATTGTAGTTAACACACAGCCATAGAGTCA

AAAACAAGGCTGGGTTGGAATTTAAAACATTATATTAACATGTCCATGTTTAGTTTAATACTGCTTTGTCGGTATCATTTTGTCATTTCTTCTTTATAAA

TCAAACACTTCAGCTGAATAATTGACCTTTATTACTGTTTCATATCTGTATTTTTAAGTCTATTTCTTAGAGAGTATAGACTAGTATACTTACAAAATAG

AAAAGTCCCAAACTCAGAGAGATAGCATATGAACCAGGGTGTACATTGGAAGATCCTGTGCTGGCCGCCTCCTCCGAATCCTCTAGGCAGCTGCTTTGAC

CTAGATTGTAGCACAACCCTGAGTCTGTCCCTTCTACCATTTGTTGTACTGTCTTCTACTTCATTCAGTATGCTTGGGAAATAGATGAGTTTGTTTTGTG

CAACACCATCTGTTTTTATAAAAGCTCGATAAAATAAAAGGTAAGTGTTTTGTATTTTATAACCTGTCAGGATTAATAACTGTTCCTAAGCTTGTTCAAT

ATTACTGGTGACTGTCAACACTGGTGTGCTGTCATTGATAGGAGAGTTCTGTTGTTTGTGTCTGTACTACTGAAGCACGAGCATAAGGGGCCAGGTGTCT

GCACTTTGTTCTTTATTCTTTCTGGCTCAACTGTCAAGTGTACATTGTTCTGTCTGATTAGGTGGAACGTGAAATCATTGTCTGACCAACTCTTAGAGGT

TTGATGTCTCATAGCAAAGTTTTATAATGGTTTTTTACATTCTGTTCCAGACTTGAAAACTACATATTAAGTGCATATTCAGTCTTGTTTATTATACAGT

AGAGGTTGAGAATATGACTCATGAAATGAATGTGCCTATCTTTTCACTTGGTATTGAATTATAAAAATAAAAGGAGTTTTTCATAAGTTC
Translation
MVWILLAK DRPEICFMKGAYEQVIKYCTTYNSKGQTLALTQQQRDLYQQEKARMGSAGLRV VLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLI

ASGVSIKMITGDSQETAIAIA ASRLGLYSKTSQSVSGEEVDTMEVQHLSQIVPK VAVFYRASPRHKMKIIK - UNI2316 - SLQKNGAVVAMTGD

GVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIM MSAIEEGKGIYNNIKNFVRFQLST TSIAALTLISLATLMNFPNPLNAMQILWINII

MDGPPAQS SLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRE LRDNVITPRDTTMTFTCFVFFDMFNALSSRSQ TKSVFEI

GLCSNKMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILD DLLFLLGLTSSVCIVSEIIKKVERSREKVQKNAGSASSSFLEV
Transcript ENSMUST00000112558
Sequence
ATTCAA - UNI19956 - - UNI31830 - GTTGCACGATTTCAAAAGATCCCTAATGTTGAAAATGAGACAATGATCCCTGTACTGACGTCAAAGA

GAGCAAGTGAGTTAGCAGTCAGTGAGGTTGCAGGCCTTCTCCAG GCTGATCTTCAGAATGGCTTAAACAAATCTGAAGTTAGTCATAGGCGAGCCTTCC

ATGGTTGGAATGAATTTGATATCAGTGAAGATGAACCATTATGGAAGAAGTATATTTCTCAG TTTAAAAATCCCCTTATCATGCTGCTCCTGGCGTCTG

CGGTCATCAGCATTTTAATGCGCCAGTTTGATGATGCCGTCAGTATCACTGTG GCAATAGTAATTGTCGTCACTGTGGCCTTTGTTCAG GAATATCGT

TCAGAAAAATCTCTAGAAGAATTGAGTAAACTTGTGCCACCAGAATGCCATTG - UNI27726 - TGTGCGTGAAGGAAAACTGGAGCATACACTTGC

CCGAGACTTGGTTCCAGGTGACACAGTTTGTCTCTCTGTGGGGGACAGAGTTCCTGCGGACTTACGCTTATTTGAG GCTGTGGATCTTTCTGTGGATGA

GTCTAGCTTGACAGGAGAGACAGCTCCGTGCTCTAAAGTGACAGCCCCTCAGCCAGCTGCTAATGGAGATCTTGCGTCAAGAAGTAACATCGCCTTCATG

GGGACACTGGTCAGATGTGGCAAAGCAAAG GGTATTGTCATTGGAACAGGAGAAAATTCTGAATTTGGAGAGGTCTTTAAGATGATGCAGGCAGAAGAA

 GCACCAAAAACTCCTCTGCAGAAGAGCATGGACCTCTTAGGCAAGCAGCTGTCCTTTTACTCCTTTGGTATAATAG GTATCATCATGTTGGTTGGCTG

GTTACTAGGAAAAGACATTCTGGAAATGTTCACTATTAGTGTAAG CTTGGCTGTAGCTGCAATTCCTGAAGGCCTGCCTATTGTGGTCACGGTGACTCT

AGCCCTTGGTGTTATGAGAATGGTGAAGAAAAGGGCTATTGTAAAGAAATTGCCTATTGTGGAAACACTGG GCTGCTGTAATGTGATTTGTTCAGATAA

AACTGGAACCCTGACGAAGAACGAGATGACTGTTACTCACATCCTCACTTCCGATGGCCTGCATGCTGAG GTCACTGGAGTTGGCTATAATCAGTTTGG

TGAAGTGATCGTTGATGGTGATGTTGTTCATGGATTTTATAACCCAGCTGTTAGCAGAATTGTTGAG GCAGGCTGTGTGTGCAATGATGCTGTAATTAG

GAACAACACTCTGATGGGAAAGCCAACTGAAGGAGCCTTAATCGCTCTTGCTATGAAG ATGGGTCTTGATGGACTGCAACAAGACTACATCAGGAAAGC

TGAATACCCTTTTAGTTCTGAGCAGAAGTGGATGGCTGTTAAGTGTGTGCACCGAACACAGCAG - UNI4231 - GACAGACCAGAGATTTGTTTTAT

GAAGGGTGCTTATGAGCAGGTGATTAAGTATTGTACTACATACAACAGCAAAGGGCAGACTTTGGCACTTACCCAGCAGCAGAGAGATTTGTATCAACAA

GAGAAGGCACGGATGGGCTCAGCGGGACTCAGAG TTCTTGCCTTGGCGTCTGGTCCGGAACTGGGGCAGCTGACCTTCCTTGGCCTGGTCGGAATCATT

GACCCTCCTAGAACTGGTGTGAAGGAAGCTGTCACAACACTCATTGCCTCAGGAGTCTCCATCAAAATGATCACTGGAGATTCTCAGGAGACTGCAATTG

CCATCG CTAGTCGTCTGGGATTGTACTCTAAGACTTCACAGTCCGTGTCTGGGGAAGAAGTCGATACAATGGAGGTGCAGCACCTTTCACAGATAGTGC

CAAAG GTTGCAGTATTTTACAGAGCAAGCCCAAGACACAAGATGAAAATTATTAAG - UNI2316 - TCTCTACAGAAGAACGGGGCAGTTGTAGCC

ATGACAGGAGATGGGGTAAATGATGCAGTTGCTCTCAAGGCTGCAGACATTGGAGTTGCGATGGGCCAGACTGGCACCGATGTTTGCAAAGAGGCTGCAG

ACATGATCTTGGTGGATGATGATTTCCAAACCATCAT GTCTGCAATAGAAGAGGGTAAAGGCATTTATAATAACATTAAAAATTTTGTTAGATTTCAAC

TGAGCAC GAGTATAGCAGCATTAACTTTAATCTCATTGGCTACGTTAATGAACTTTCCTAACCCTCTCAATGCAATGCAGATTTTGTGGATCAATATTA

TAATGGATGGACCCCCAGCTCAGAG CCTTGGAGTAGAGCCAGTGGATAAAGATGTCATTCGAAAACCGCCTCGAAACTGGAAGGACAGCATTTTGACAA

AAAACTTGATACTTAAAATACTTGTTTCATCAATAATCATTGTTTGTGGGACTTTGTTTGTCTTCTGGCGAGAG CTTCGAGACAATGTGATAACACCCC

GAGACACAACCATGACTTTCACTTGCTTTGTGTTTTTTGACATGTTCAATGCACTGAGTTCCAGATCTCAG ACCAAGTCTGTGTTTGAGATTGGACTCT

GCAGTAATAAGATGTTCTGCTATGCAGTTCTTGGATCCATCATGGGACAGTTGCTTGTCATTTACTTCCCTCCTCTCCAGAAGGTTTTTCAAACCGAGAG

CCTGAGTATACTGG ATCTGTTGTTTCTTTTGGGCCTTACCTCGTCAGTGTGCATTGTGTCTGAGATTATAAAGAAGGTTGAAAGGAGCCGGGAGAAGGT

CCAGAAGAATGCTGGTTCAGCATCATCGTCTTTCCTTGAAGTATGATGCATATTGCATTTTTTTTTAATTTGCAAACTAGGAATTGCAGTCTGAGAATCA

TTTAGAAGGGCAAGTTCAAGAAGATAATGAAGACTTAAGGACTTTTTTAACTTTCCATTGACTAAAAATGACCATTAATGTTAAAGACTTGATTTGAACT

TTGTTGGTAGTCCCAAATGAAATTATGCAACTTTGAATAACACATTCCTTGATTTGAATTGGCTTTTGCAATTGAGTGAACTTCAACATATGGGCAAGTA

CTGAATTAAAAAATACAAAAGGCAAAACCTGAACCACCTTCTGCACTTAAAGAATTCTAATGTACAAATACACTGTCTGTCTTAGATGGATATAAATATT

TTTTTTATTTTTAAATATTGTACTATTTATGGTTGTGGGGCTTTCTTACTAACACACAAATAAACTCAATCATTTAAAGGCATTCTATTTGGTTTAGAAA

TTGCCAGGGGTGCCGTATTTCAGCTACCGTGCTTCCTTTTTCCTGAAATGTAAGCAACTGATACCTTGTGCTACCATTTTTATATTTCAAGTTGTTTTTT

TTTTTTTTTTGCACAGGATGTGACCACTGTCTAATCACTGTTCTTTTCTTTCTTTTTGTGACTGAAAAGCATATACTGCAATTGAAGTAAATGTTTGCTC

TTCTTAGTAAGTGTAAATGGTTGTTTTTTGGTTTTTTTGTAGTTTTGTTTTGCATAGAGGAACGAGTCTTTGATCTAGCAGAATTATTAGTTCAGGGCTG

TTATTGGCATTACAGTTAGAGTAATTGTAGTTAACACACAGCCATAGAGTCAAAAACAAGGCTGGGTTGGAATTTAAAACATTATATTAACATGTCCATG

TTTAGTTTAATACTGCTTTGTCGGTATCATTTTGTCATTTCTTCTTTATAAATCAAACACTTCAGCTGAATAATTGACCTTTATTACTGTTTCATATCTG

TATTTTTAAGTCTATTTCTTAGAGAGTATAGACTAGTATACTTACAAAATAGAAAAGTCCCAAACTCAGAGAGATAGCATATGAACCAGGGTGTACATTG

GAAGATCCTGTGCTGGCCGCCTCCTCCGAATCCTCTAGGCAGCTGCTTTGACCTAGATTGTAGCACAACCCTGAGTCTGTCCCTTCTACCATTTGTTGTA

CTGTCTTCTACTTCATTCAGTATGCTTGGGAAATAGATGAGTTTGTTTTGTGCAACACCATCTGTTTTTATAAAAGCTCGATAAAATAAAAGGTAAGTGT

TTTGTATTTTATAACCTGTCAGGATTAATAACTGTTCCTAAGCTTGTTCAATATTACTGGTGACTGTCAACACTGGTGTGCTGTCATTGATAGGAGAGTT

CTGTTGTTTGTGTCTGTACTACTGAAGCACGAGCATAAGGGGCCAGGTGTCTGCACTTTGTTCTTTATTCTTTCTGGCTCAACTGTCAAGTGTACATTGT

TCTGTCTGATTAGGTGGAACGTGAAATCATTGTCTGACCAACTCTTAGAGGTTTGATGTCTCATAGCAAAGTTTTATAATGGTTTTTTACATTCTGTTCC

AGACTTGAAAACTACATATTAAGTGCATATTCAGTCTTGTTTATTATACAGTAGAGGTTGAGAATATGACTCATGAAATGAATGTGCCTATCTTTTCACT

TGGTATTGAATTATAAAAATAAAAGGAGTTTTTCATAAGTTC
Translation
IQ - UNI19956 - - UNI31830 - VARFQKIPNVENETMIPVLTSKRASELAVSEVAGLLQ ADLQNGLNKSEVSHRRAFHGWNEFDISEDEPLW

KKYISQ FKNPLIMLLLASAVISILMRQFDDAVSITV AIVIVVTVAFVQ EYRSEKSLEELSKLVPPECHC - UNI27726 - CVREGKLEHTLARD

LVPGDTVCLSVGDRVPADLRLFE AVDLSVDESSLTGETAPCSKVTAPQPAANGDLASRSNIAFMGTLVRCGKAK GIVIGTGENSEFGEVFKMMQAEE 

APKTPLQKSMDLLGKQLSFYSFGIIG GIIMLVGWLLGKDILEMFTISVS SLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLG GCCNV

ICSDKTGTLTKNEMTVTHILTSDGLHAE VTGVGYNQFGEVIVDGDVVHGFYNPAVSRIVE AGCVCNDAVIRNNTLMGKPTEGALIALAMK MGLDGLQ

QDYIRKAEYPFSSEQKWMAVKCVHRTQQ - UNI4231 - DRPEICFMKGAYEQVIKYCTTYNSKGQTLALTQQQRDLYQQEKARMGSAGLRV VLALA

SGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAIAIA ASRLGLYSKTSQSVSGEEVDTMEVQHLSQIVPK VAVFYRASPRHK

MKIIK - UNI2316 - SLQKNGAVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIM MSAIEEGKGIYNNIKNFVRFQLST 

TSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQS SLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRE LRDNVITP

RDTTMTFTCFVFFDMFNALSSRSQ TKSVFEIGLCSNKMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILD DLLFLLGLTSSVCIVSEIIKKVERSR

EKVQKNAGSASSSFLEV
Transcript ENSMUST00000038118
Sequence
CGCAGGAGGCGGAGGCGGGAGCAGAGCTGCTCGGCCGTGCGCGGAGACGCGCGGAGCCGGCGGGCCGAGCTTGACGGGCCCTTCGCCGCTCCTCCTCTCC

CCTCCCTGCCGCCGTCCTGCTCCTTCTCCTCGGGACGTGTGGCGCCGCTGTGCTGCCAGCAGCTCCGGGTCGCCCGAGGCGCGTGGGGCGCCCCCGCAGC

CCCGCGA - UNI31830 - ATGCTGCTGCTAGGGGTGGTGGGAGCAGCCGTGGGACGCGTGGCCGGGAGCGGGGGTGACAGCCTGGGATTCCGGGGTC

TTCTCTTCCTTGTCCTCCTCTCCTCTCTATTCCCAGTGTGGCCGTGGCTGACACTAAAGACTTTGTAGCCATCAACCAGAGTGCAGTTTCGATGGAAAAT

GAAG - UNI19956 - - UNI31830 - GTTGCACGATTTCAAAAGATCCCTAATGTTGAAAATGAGACAATGATCCCTGTACTGACGTCAAAGAGA

GCAAGTGAGTTAGCAGTCAGTGAGGTTGCAGGCCTTCTCCAG GCTGATCTTCAGAATGGCTTAAACAAATCTGAAGTTAGTCATAGGCGAGCCTTCCAT

GGTTGGAATGAATTTGATATCAGTGAAGATGAACCATTATGGAAGAAGTATATTTCTCAG TTTAAAAATCCCCTTATCATGCTGCTCCTGGCGTCTGCG

GTCATCAGCATTTTAATGCGCCAGTTTGATGATGCCGTCAGTATCACTGTG GCAATAGTAATTGTCGTCACTGTGGCCTTTGTTCAG GAATATCGTTC

AGAAAAATCTCTAGAAGAATTGAGTAAACTTGTGCCACCAGAATGCCATTG - UNI27726 - TGTGCGTGAAGGAAAACTGGAGCATACACTTGCCC

GAGACTTGGTTCCAGGTGACACAGTTTGTCTCTCTGTGGGGGACAGAGTTCCTGCGGACTTACGCTTATTTGAG GCTGTGGATCTTTCTGTGGATGAGT

CTAGCTTGACAGGAGAGACAGCTCCGTGCTCTAAAGTGACAGCCCCTCAGCCAGCTGCTAATGGAGATCTTGCGTCAAGAAGTAACATCGCCTTCATGGG

GACACTGGTCAGATGTGGCAAAGCAAAG GGTATTGTCATTGGAACAGGAGAAAATTCTGAATTTGGAGAGGTCTTTAAGATGATGCAGGCAGAAGAA G

CACCAAAAACTCCTCTGCAGAAGAGCATGGACCTCTTAGGCAAGCAGCTGTCCTTTTACTCCTTTGGTATAATAG GTATCATCATGTTGGTTGGCTGGT

TACTAGGAAAAGACATTCTGGAAATGTTCACTATTAGTGTAAG CTTGGCTGTAGCTGCAATTCCTGAAGGCCTGCCTATTGTGGTCACGGTGACTCTAG

CCCTTGGTGTTATGAGAATGGTGAAGAAAAGGGCTATTGTAAAGAAATTGCCTATTGTGGAAACACTGG GCTGCTGTAATGTGATTTGTTCAGATAAAA

CTGGAACCCTGACGAAGAACGAGATGACTGTTACTCACATCCTCACTTCCGATGGCCTGCATGCTGAG GTCACTGGAGTTGGCTATAATCAGTTTGGTG

AAGTGATCGTTGATGGTGATGTTGTTCATGGATTTTATAACCCAGCTGTTAGCAGAATTGTTGAG GCAGGCTGTGTGTGCAATGATGCTGTAATTAGGA

ACAACACTCTGATGGGAAAGCCAACTGAAGGAGCCTTAATCGCTCTTGCTATGAAG ATGGGTCTTGATGGACTGCAACAAGACTACATCAGGAAAGCTG

AATACCCTTTTAGTTCTGAGCAGAAGTGGATGGCTGTTAAGTGTGTGCACCGAACACAGCAG - UNI4231 - GACAGACCAGAGATTTGTTTTATGA

AGGGTGCTTATGAGCAGGTGATTAAGTATTGTACTACATACAACAGCAAAGGGCAGACTTTGGCACTTACCCAGCAGCAGAGAGATTTGTATCAACAAGA

GAAGGCACGGATGGGCTCAGCGGGACTCAGAG TTCTTGCCTTGGCGTCTGGTCCGGAACTGGGGCAGCTGACCTTCCTTGGCCTGGTCGGAATCATTGA

CCCTCCTAGAACTGGTGTGAAGGAAGCTGTCACAACACTCATTGCCTCAGGAGTCTCCATCAAAATGATCACTGGAGATTCTCAGGAGACTGCAATTGCC

ATCG CTAGTCGTCTGGGATTGTACTCTAAGACTTCACAGTCCGTGTCTGGGGAAGAAGTCGATACAATGGAGGTGCAGCACCTTTCACAGATAGTGCCA

AAG GTTGCAGTATTTTACAGAGCAAGCCCAAGACACAAGATGAAAATTATTAAG - UNI2316 - TCTCTACAGAAGAACGGGGCAGTTGTAGCCAT

GACAGGAGATGGGGTAAATGATGCAGTTGCTCTCAAGGCTGCAGACATTGGAGTTGCGATGGGCCAGACTGGCACCGATGTTTGCAAAGAGGCTGCAGAC

ATGATCTTGGTGGATGATGATTTCCAAACCATCAT GTCTGCAATAGAAGAGGGTAAAGGCATTTATAATAACATTAAAAATTTTGTTAGATTTCAACTG

AGCAC GAGTATAGCAGCATTAACTTTAATCTCATTGGCTACGTTAATGAACTTTCCTAACCCTCTCAATGCAATGCAGATTTTGTGGATCAATATTATA

ATGGATGGACCCCCAGCTCAGAG CCTTGGAGTAGAGCCAGTGGATAAAGATGTCATTCGAAAACCGCCTCGAAACTGGAAGGACAGCATTTTGACAAAA

AACTTGATACTTAAAATACTTGTTTCATCAATAATCATTGTTTGTGGGACTTTGTTTGTCTTCTGGCGAGAG CTTCGAGACAATGTGATAACACCCCGA

GACACAACCATGACTTTCACTTGCTTTGTGTTTTTTGACATGTTCAATGCACTGAGTTCCAGATCTCAG ACCAAGTCTGTGTTTGAGATTGGACTCTGC

AGTAATAAGATGTTCTGCTATGCAGTTCTTGGATCCATCATGGGACAGTTGCTTGTCATTTACTTCCCTCCTCTCCAGAAGGTTTTTCAAACCGAGAGCC

TGAGTATACTGG ATCTGTTGTTTCTTTTGGGCCTTACCTCGTCAGTGTGCATTGTGTCTGAGATTATAAAGAAGGTTGAAAGGAGCCGGGAGAAGGTCC

AGAAGAATGCTGGTTCAGCATCATCGTCTTTCCTTGAAGTATGATGCATATTGCATTTTTTTTTAATTTGCAAACTAGGAATTGCAGTCTGAGAATCATT

TAGAAGGGCAAGTTCAAGAAGATAATGAAGACTTAAGGACTTTTTTAACTTTCCATTGACTAAAAATGACCATTAATGTTAAAGACTTGATTTGAACTTT

GTTGGTAGTCCCAAATGAAATTATGCAACTTTGAATAACACATTCCTTGATTTGAATTGGCTTTTGCAATTGAGTGAACTTCAACATATGGGCAAGTACT

GAATTAAAAAATACAAAAGGCAAAACCTGAACCACCTTCTGCACTTAAAGAATTCTAATGTACAAATACACTGTCTGTCTTAGATGGATATAAATATTTT

TTTTATTTTTAAATATTGTACTATTTATGGTTGTGGGGCTTTCTTACTAACACACAAATAAACTCAATCATTTAAAGGCATTCTATTTGGTTTAGAAATT

GCCAGGGGTGCCGTATTTCAGCTACCGTGCTTCCTTTTTCCTGAAATGTAAGCAACTGATACCTTGTGCTACCATTTTTATATTTCAAGTTGTTTTTTTT

TTTTTTTTGCACAGGATGTGACCACTGTCTAATCACTGTTCTTTTCTTTCTTTTTGTGACTGAAAAGCATATACTGCAATTGAAGTAAATGTTTGCTCTT

CTTAGTAAGTGTAAATGGTTGTTTTTTGGTTTTTTTGTAGTTTTGTTTTGCATAGAGGAACGAGTCTTTGATCTAGCAGAATTATTAGTTCAGGGCTGTT

ATTGGCATTACAGTTAGAGTAATTGTAGTTAACACACAGCCATAGAGTCAAAAACAAGGCTGGGTTGGAATTTAAAACATTATATTAACATGTCCATGTT

TAGTTTAATACTGCTTTGTCGGTATCATTTTGTCATTTCTTCTTTATAAATCAAACACTTCAGCTGAATAATTGACCTTTATTACTGTTTCATATCTGTA

TTTTTAAGTCTATTTCTTAGAGAGTATAGACTAGTATACTTACAAAATAGAAAAGTCCCAAACTCAGAGAGATAGCATATGAACCAGGGTGTACATTGGA

AGATCCTGTGCTGGCCGCCTCCTCCGAATCCTCTAGGCAGCTGCTTTGACCTAGATTGTAGCACAACCCTGAGTCTGTCCCTTCTACCATTTGTTGTACT

GTCTTCTACTTCATTCAGTATGCTTGGGAAATAGATGAGTTTGTTTTGTGCAACACCATCTGTTTTTATAAAAGCTCGATAAAATAAAAGGTAAGTGTTT

TGTATTTTATAACCTGTCAGGATTAATAACTGTTCCTAAGCTTGTTCAATATTACTGGTGACTGTCAACACTGGTGTGCTGTCATTGATAGGAGAGTTCT

GTTGTTTGTGTCTGTACTACTGAAGCACGAGCATAAGGGGCCAGGTGTCTGCACTTTGTTCTTTATTCTTTCTGGCTCAACTGTCAAGTGTACATTGTTC

TGTCTGATTAGGTGGAACGTGAAATCATTGTCTGACCAACTCTTAGAGGTTTGATGTCTCATAGCAAAGTTTTATAATGGTTTTTTACATTCTGTTCCAG

ACTTGAAAACTACATATTAAGTGCATATTCAGTCTTGTTTATTATACAGTAGAGGTTGAGAATATGACTCATGAAATGAATGTGCCTATCTTTTCACTTG

GTATTGAATTATAAAAATAAAAGGAGTTTTTCATAAGTTC
Translation
 - UNI31830 - MK - UNI19956 - - UNI31830 - VARFQKIPNVENETMIPVLTSKRASELAVSEVAGLLQ ADLQNGLNKSEVSHRRAFH

GWNEFDISEDEPLWKKYISQ FKNPLIMLLLASAVISILMRQFDDAVSITV AIVIVVTVAFVQ EYRSEKSLEELSKLVPPECHC - UNI27726 - 

CVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFE AVDLSVDESSLTGETAPCSKVTAPQPAANGDLASRSNIAFMGTLVRCGKAK GIVIGTGENS

EFGEVFKMMQAEE APKTPLQKSMDLLGKQLSFYSFGIIG GIIMLVGWLLGKDILEMFTISVS SLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKK

LPIVETLG GCCNVICSDKTGTLTKNEMTVTHILTSDGLHAE VTGVGYNQFGEVIVDGDVVHGFYNPAVSRIVE AGCVCNDAVIRNNTLMGKPTEGAL

IALAMK MGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQ - UNI4231 - DRPEICFMKGAYEQVIKYCTTYNSKGQTLALTQQQRDLYQQEKAR

MGSAGLRV VLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAIAIA ASRLGLYSKTSQSVSGEEVDTMEVQHLSQIVP

K VAVFYRASPRHKMKIIK - UNI2316 - SLQKNGAVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIM MSAIEEGKGIY

NNIKNFVRFQLST TSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQS SLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLF

VFWRE LRDNVITPRDTTMTFTCFVFFDMFNALSSRSQ TKSVFEIGLCSNKMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILD DLLFLLGLTSSV

CIVSEIIKKVERSREKVQKNAGSASSSFLEV
Transcript ENSMUST00000085133
Sequence
ATGGAGAACTTATTGCCTCCGTCCGGATTTTCTTACTTGAAAAAGTATCCTCTCCACTCTATTCGGAAATATTTATCAACGCTGAGAAGCCAAAGGGCCG

AAGAGCAG - UNI19956 - - UNI31830 - GTTGCACGATTTCAAAAGATCCCTAATGTTGAAAATGAGACAATGATCCCTGTACTGACGTCAAA

GAGAGCAAGTGAGTTAGCAGTCAGTGAGGTTGCAGGCCTTCTCCAG GCTGATCTTCAGAATGGCTTAAACAAATCTGAAGTTAGTCATAGGCGAGCCTT

CCATGGTTGGAATGAATTTGATATCAGTGAAGATGAACCATTATGGAAGAAGTATATTTCTCAG TTTAAAAATCCCCTTATCATGCTGCTCCTGGCGTC

TGCGGTCATCAGCATTTTAATGCGCCAGTTTGATGATGCCGTCAGTATCACTGTG GCAATAGTAATTGTCGTCACTGTGGCCTTTGTTCAG GAATATC

GTTCAGAAAAATCTCTAGAAGAATTGAGTAAACTTGTGCCACCAGAATGCCATTG - UNI27726 - TGTGCGTGAAGGAAAACTGGAGCATACACTT

GCCCGAGACTTGGTTCCAGGTGACACAGTTTGTCTCTCTGTGGGGGACAGAGTTCCTGCGGACTTACGCTTATTTGAG GCTGTGGATCTTTCTGTGGAT

GAGTCTAGCTTGACAGGAGAGACAGCTCCGTGCTCTAAAGTGACAGCCCCTCAGCCAGCTGCTAATGGAGATCTTGCGTCAAGAAGTAACATCGCCTTCA

TGGGGACACTGGTCAGATGTGGCAAAGCAAAG GGTATTGTCATTGGAACAGGAGAAAATTCTGAATTTGGAGAGGTCTTTAAGATGATGCAGGCAGAAG

AA GCACCAAAAACTCCTCTGCAGAAGAGCATGGACCTCTTAGGCAAGCAGCTGTCCTTTTACTCCTTTGGTATAATAG GTATCATCATGTTGGTTGGC

TGGTTACTAGGAAAAGACATTCTGGAAATGTTCACTATTAGTGTAAG CTTGGCTGTAGCTGCAATTCCTGAAGGCCTGCCTATTGTGGTCACGGTGACT

CTAGCCCTTGGTGTTATGAGAATGGTGAAGAAAAGGGCTATTGTAAAGAAATTGCCTATTGTGGAAACACTGG GCTGCTGTAATGTGATTTGTTCAGAT

AAAACTGGAACCCTGACGAAGAACGAGATGACTGTTACTCACATCCTCACTTCCGATGGCCTGCATGCTGAG GTCACTGGAGTTGGCTATAATCAGTTT

GGTGAAGTGATCGTTGATGGTGATGTTGTTCATGGATTTTATAACCCAGCTGTTAGCAGAATTGTTGAG GCAGGCTGTGTGTGCAATGATGCTGTAATT

AGGAACAACACTCTGATGGGAAAGCCAACTGAAGGAGCCTTAATCGCTCTTGCTATGAAG ATGGGTCTTGATGGACTGCAACAAGACTACATCAGGAAA

GCTGAATACCCTTTTAGTTCTGAGCAGAAGTGGATGGCTGTTAAGTGTGTGCACCGAACACAGCAG - UNI4231 - GACAGACCAGAGATTTGTTTT

ATGAAGGGTGCTTATGAGCAGGTGATTAAGTATTGTACTACATACAACAGCAAAGGGCAGACTTTGGCACTTACCCAGCAGCAGAGAGATTTGTATCAAC

AAGAGAAGGCACGGATGGGCTCAGCGGGACTCAGAG TTCTTGCCTTGGCGTCTGGTCCGGAACTGGGGCAGCTGACCTTCCTTGGCCTGGTCGGAATCA

TTGACCCTCCTAGAACTGGTGTGAAGGAAGCTGTCACAACACTCATTGCCTCAGGAGTCTCCATCAAAATGATCACTGGAGATTCTCAGGAGACTGCAAT

TGCCATCG CTAGTCGTCTGGGATTGTACTCTAAGACTTCACAGTCCGTGTCTGGGGAAGAAGTCGATACAATGGAGGTGCAGCACCTTTCACAGATAGT

GCCAAAG GTTGCAGTATTTTACAGAGCAAGCCCAAGACACAAGATGAAAATTATTAAG - UNI2316 - TCTCTACAGAAGAACGGGGCAGTTGTAG

CCATGACAGGAGATGGGGTAAATGATGCAGTTGCTCTCAAGGCTGCAGACATTGGAGTTGCGATGGGCCAGACTGGCACCGATGTTTGCAAAGAGGCTGC

AGACATGATCTTGGTGGATGATGATTTCCAAACCATCAT GTCTGCAATAGAAGAGGGTAAAGGCATTTATAATAACATTAAAAATTTTGTTAGATTTCA

ACTGAGCAC GAGTATAGCAGCATTAACTTTAATCTCATTGGCTACGTTAATGAACTTTCCTAACCCTCTCAATGCAATGCAGATTTTGTGGATCAATAT

TATAATGGATGGACCCCCAGCTCAGAG CCTTGGAGTAGAGCCAGTGGATAAAGATGTCATTCGAAAACCGCCTCGAAACTGGAAGGACAGCATTTTGAC

AAAAAACTTGATACTTAAAATACTTGTTTCATCAATAATCATTGTTTGTGGGACTTTGTTTGTCTTCTGGCGAGAG CTTCGAGACAATGTGATAACACC

CCGAGACACAACCATGACTTTCACTTGCTTTGTGTTTTTTGACATGTTCAATGCACTGAGTTCCAGATCTCAG ACCAAGTCTGTGTTTGAGATTGGACT

CTGCAGTAATAAGATGTTCTGCTATGCAGTTCTTGGATCCATCATGGGACAGTTGCTTGTCATTTACTTCCCTCCTCTCCAGAAGGTTTTTCAAACCGAG

AGCCTGAGTATACTGG ATCTGTTGTTTCTTTTGGGCCTTACCTCGTCAGTGTGCATTGTGTCTGAGATTATAAAGAAGGTTGAAAGGAGCCGGGAGAAG

GTCCAGAAGAATGCTGGTTCAGCATCATCGTCTTTCCTTGAAGTATGATGCATATTGCATTTTTTTTTAATTTGCAAACTAGGAATTGCAGTCTGAGAAT

CATTTAGAAGGGCAAGTTCAAGAAGATAATGAAGACTTAAGGACTTTTTTAACTTTCCATTGACTAAAAATGACCATTAATGTTAAAGACTTGATTTGAA

CTTTGTTGGTAGTCCCAAATGAAATTATGCAACTTTGAATAACACATTCCTTGATTTGAATTGGCTTTTGCAATTGAGTGAACTTCAACATATGGGCAAG

TACTGAATTAAAAAATACAAAAGGCAAAACCTGAACCACCTTCTGCACTTAAAGAATTCTAATGTACAAATACACTGTCTGTCTTAGATGGATATAAATA

TTTTTTTTATTTTTAAATATTGTACTATTTATGGTTGTGGGGCTTTCTTACTAACACACAAATAAACTCAATCATTTAAAGGCATTCTATTTGGTTTAGA

AATTGCCAGGGGTGCCGTATTTCAGCTACCGTGCTTCCTTTTTCCTGAAATGTAAGCAACTGATACCTTGTGCTACCATTTTTATATTTCAAGTTGTTTT

TTTTTTTTTTTTGCACAGGATGTGACCACTGTCTAATCACTGTTCTTTTCTTTCTTTTTGTGACTGAAAAGCATATACTGCAATTGAAGTAAATGTTTGC

TCTTCTTAGTAAGTGTAAATGGTTGTTTTTTGGTTTTTTTGTAGTTTTGTTTTGCATAGAGGAACGAGTCTTTGATCTAGCAGAATTATTAGTTCAGGGC

TGTTATTGGCATTACAGTTAGAGTAATTGTAGTTAACACACAGCCATAGAGTCAAAAACAAGGCTGGGTTGGAATTTAAAACATTATATTAACATGTCCA

TGTTTAGTTTAATACTGCTTTGTCGGTATCATTTTGTCATTTCTTCTTTATAAATCAAACACTTCAGCTGAATAATTGACCTTTATTACTGTTTCATATC

TGTATTTTTAAGTCTATTTCTTAGAGAGTATAGACTAGTATACTTACAAAATAGAAAAGTCCCAAACTCAGAGAGATAGCATATGAACCAGGGTGTACAT

TGGAAGATCCTGTGCTGGCCGCCTCCTCCGAATCCTCTAGGCAGCTGCTTTGACCTAGATTGTAGCACAACCCTGAGTCTGTCCCTTCTACCATTTGTTG

TACTGTCTTCTACTTCATTCAGTATGCTTGGGAAATAGATGAGTTTGTTTTGTGCAACACCATCTGTTTTTATAAAAGCTCGATAAAATAAAAGGTAAGT

GTTTTGTATTTTATAACCTGTCAGGATTAATAACTGTTCCTAAGCTTGTTCAATATTACTGGTGACTGTCAACACTGGTGTGCTGTCATTGATAGGAGAG

TTCTGTTGTTTGTGTCTGTACTACTGAAGCACGAGCATAAGGGGCCAGGTGTCTGCACTTTGTTCTTTATTCTTTCTGGCTCAACTGTCAAGTGTACATT

GTTCTGTCTGATTAGGTGGAACGTGAAATCATTGTCTGACCAACTCTTAGAGGTTTGATGTCTCATAGCAAAGTTTTATAATGGTTTTTTACATTCTGTT

CCAGACTTGAAAACTACATATTAAGTGCATATTCAGTCTTGTTTATTATACAGTAGAGGTTGAGAATATGACTCATGAAATGAATGTGCCTATCTTTTCA

CTTGGTATTGAATTATAAAAATAAAAGGAGTTTTTCATAAGTTC
Translation
MENLLPPSGFSYLKKYPLHSIRKYLSTLRSQRAEEQ - UNI19956 - - UNI31830 - VARFQKIPNVENETMIPVLTSKRASELAVSEVAGLLQ

 ADLQNGLNKSEVSHRRAFHGWNEFDISEDEPLWKKYISQ FKNPLIMLLLASAVISILMRQFDDAVSITV AIVIVVTVAFVQ EYRSEKSLEELSKLV

PPECHC - UNI27726 - CVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFE AVDLSVDESSLTGETAPCSKVTAPQPAANGDLASRSNIAFMG

TLVRCGKAK GIVIGTGENSEFGEVFKMMQAEE APKTPLQKSMDLLGKQLSFYSFGIIG GIIMLVGWLLGKDILEMFTISVS SLAVAAIPEGLPIVV

TVTLALGVMRMVKKRAIVKKLPIVETLG GCCNVICSDKTGTLTKNEMTVTHILTSDGLHAE VTGVGYNQFGEVIVDGDVVHGFYNPAVSRIVE AGCV

CNDAVIRNNTLMGKPTEGALIALAMK MGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQ - UNI4231 - DRPEICFMKGAYEQVIKYCTTYNSK

GQTLALTQQQRDLYQQEKARMGSAGLRV VLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAIAIA ASRLGLYSKTSQ

SVSGEEVDTMEVQHLSQIVPK VAVFYRASPRHKMKIIK - UNI2316 - SLQKNGAVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILV

DDDFQTIM MSAIEEGKGIYNNIKNFVRFQLST TSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQS SLGVEPVDKDVIRKPPRNWKDSILT

KNLILKILVSSIIIVCGTLFVFWRE LRDNVITPRDTTMTFTCFVFFDMFNALSSRSQ TKSVFEIGLCSNKMFCYAVLGSIMGQLLVIYFPPLQKVFQT

ESLSILD DLLFLLGLTSSVCIVSEIIKKVERSREKVQKNAGSASSSFLEV

For any suggestions or comments, please send an email to unitrap@crg.es