Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032571 (Pik3r4)
Chromosomal location
Chr 9: 105545325 - 105589985 (+)
Description
phosphatidylinositol 3 kinase, regulatory subunit, polypeptide 4, p150 Gene [Source:MGI Symbol;Acc:MGI:1922919]
RefSeq_dna
NM_001081309 
RefSeq_peptide
NP_001074778.1 
MGI
MGI:1922919 
Uniprot/SWISSPROT
Q8VD65 
Uniprot/SPTREMBL
B2RXR2 B2RY05 
Human Ortholog
ENSG00000196455 (PIK3R4)
Omim not available
UniTrap UNI26884
Vector Insertion
Chr 9: 105545721 - 105546525
Public Clones IST14479B10 (tigm)
Private Clones OST88295 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29679
Vector Insertion
Chr 9: 105563813 - 105565371
Public Clones E120B03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000065778
Sequence
GAGGCTTTCCCGGGAGTTCAGCGTTTGCCGCAGGTGAAGTCGTCTTCCTGGACGGGCACTGTCCCTGTCCCTGTCCCTGTCCAGGGCTGCTGCAAAGGCC

CTGGGATCCGGGGACTCGAACCCGCGGGGGCCCAGGGCGGCAGGGGAGGAGCCGGCAGCGAGGCTGCTGGGTGTCCGGAGTCCCGAGTGTGTTTGCTCTC

CCAGTTGTTCACCCCCAGCTCTAGATCTCGGACGTGTCTGCGCTCCTGCCCCAACTACCCCGGTCCCGTGTCTGAAAGAAGACCCCTCACAGAAAACATT

CTCCTGGCCGGCTTCCGTTCACGCCCAAGCCCCTCGGAGCTCTGCCAAGACCTCCCTGGGATCTTTCAGCGACTTTTGAGTTGCCAGAGGCCTGGG - U

NI26884 - GTGTTCTGTGTTAAGCTGCTGTCCCAGAGGTGCTGGGCATTATGGGAAATCAGCTGGCTGGCATCGCTCCTTCCCAGATCCTGTCTGTAG

AGAGTTATTTCTCAGACATCCATGACTTTGAGTATGATAAGAGCCTGGGAAGCACTCGGTTTTTTAAAGTCGCTCGAGCCAAGCACCGGGAAGGCCTGGT

GGTTGTGAAGGTCTTTGCAATTCAGGATCCCACGTTACCCTTAACTAGTTATAAACAGGAGCTGGAGGAACTGAAAATCAGGCTCCACTCCGCCCAGAAC

TGCCTCCCCTTCCAGAAAGCAGCAGAAAAGGCGTCTGAGAAAGCAGCCATGCTGTTCCGGCAGTATGTGAGAGACAACCTCTACGATCGCATCAGTACCC

GCCCGTTCCTAAACAACATCGAGAAGCGCTGGATCGCCTTCCAGATCCTGACGGCCGTGGACCAAGCGCACAAATCTGGAGTCCGCCACGGAGACATCAA

GACAGAGAATGTGATGGTCACCAGTTGGAACTGGGTCCTCCTAACCGACTTCGCCAGTTTTAAGCCCACGTATCTTCCCGAGGACAACCCAGCGGATTTC

AACTATTTCTTTGACACCTCGAGAAGGAGGACATGCTACATAGCTCCCGAGCGCTTCGTTGACGGTGGGATGTTCGCCACCGAGTTAGAGTACATGAGAG

ACCCCTCAACCCCGCTTGTCGACCTGAATAGCAATCAGAGAGCGCGGGGAGAGCTGAAGAGAGCCATGGACATCTTTTCGGCAG GTTGCGTGATAGCTG

AGCTCTTTACGGAAGGCGTACCTTTGTTTGATCTCTCTCAGCTGCTGGCGTATAGAAACGGACATTTTTTCCCTGAACAAGTGCTAAACAAAATTGAAGA

TCGCAGTATCAGAGACTTG GTAACTCAGATGATTAACCGTGAGCCCGAGAAGCGTTTGGAAGCTGAGGACTACCTGAAGCAGCAGCGAGGCAACGCCTT

CCCTGAGATATTTTATACTTTCCTTCAGCCTTACATGGCCCAGTTCGCCAAGGAAACCTTTCTCTCTGCAGATGAGCGGATTTTGGTTATACGGAAAGAT

TTGGGCAACATTATTCACAACCTCTGTGGACATGATTTGCCAGAAAAAGCAGAAGGGGAGTCCAGGGCCAGTGGTCTGGTTGTCCTGGTGTCCGTGATAA

CGTCCTGCCTGCAGACACTGAAGTCCTGCGACTCCAAACTGGCCGCCTTGGAGCTCATCCTGCATCTGGCCCCCAGACTGAGCGTCGAGATCCTTCTGGA

TCGCATCACTCCCTACCTGTTGCATTTCAGCAATGACTCTGTCCCAAGAGTGCGGGCTGAAGCCCTGAGGACACTCACCAAAGTCCTTGCCCTTGTCCAA

GAGGTTCCTCGCAACGATGTCAATATCTATCCAGAGTATATTCTCCCCGGCATAGCCCACCTGGCCCAGGATGACGCTACCATCGTCAGACTGGCCTACG

CTG AAAACATAGCTCTGTTGGCCGAGACGGCTCTGCGATTCCTGGAGCTTGTGCAGCTGAAAACTCTCAACATGGAGAACGAGCCCGATAACGAGGAGG

TAGATGAAGCCACGCGTCCTAACGGAGACTATGACACAG AGCTCCAGGCCTTGCATGAGATGGTCCAGCAGAAGGTGGTCACGTTGCTAAGCGACCCTG

AGAATATCGTGAAACAGACGCTGATGGAGAGTGGGATCACACGCTTGTGCGTCTTCTTCGGACGCCAGAAGGCCAACGACGTTCTCTTGTCCCACATGAT

CACTTTCCTCAATGATAAGAATGATTGGCACCTGCGTGGAGCTTTCTTTGATAGCATAGTCG GTGTGGCTGCCTACGTTGGCTGGCAGAGCTCCTCTAT

CCTCAAGCCCCTGCTCCAGCAAGGCCTCAGCGATGCTGAGGAGTTTGTCATCGTGAAAGCTCTCAATGCCCTGACCTGCATGTGCCAGCTAGGGCTGCTG

CAGAAACCCCATGTCTACGAGTTCGCCAGTGATATTG CTCCCTTCCTGTGTCACCCTAACCTGTGGATACGCTATGGCGCTGTGGGATTTATCACGGTG

GTAGCTCATCAGATCAGTACTGCTGATGTCTACTGCAAGCTCATGCCGTATCTTGACCCGTATATTACACAGCCAGTGATACAG - UNI29679 - AT

TGAGAGGAAGCTGGTCCTGCTCAGTGTGCTAAAGGAGCCGGTGAGCCGCTCCATATTTGACTATGCTCTGAGGTCGAAAGACATCGCCAGCTTGTTCAGA

CATCTCCACATGCGCCAGAAGAAGCGAAATGGCTCTCTTCTCGACTGCCCTCCACCTGAGGACCCCACCATAGCGCAACTTCTGAAGAAGTTGCTCTCAC

AG GGGATGACTGAAGAAGAGGAAGATAAACTTCTGGCACTGAAGGACTTCATGATGAAATCAAATCGAGCCAAAGCTAATGCGGTAGACCAGAGCCACC

TCCACGACAGCAGCCAGAAAGGTGTAATCGACTTGGCCGCCTTAGGCATCACTGGGAGACAAGTTGATCTTGTTAAAACCAAACAAGAACCAGATGAGAA

ACGTG CTAGGAAACATGTGAAACAAGACTCCAATGTAAATGAAGAGTGGAAAAGCATGTTTGGGTCATTGGAGCCACCGAATATCCCACAGGCCCTGCC

TAAAACCAGTGACCATGAGGTTGTTCAGCCTGGGAAGCCACCTCGCTCTGAGTCCTCTGCTGGTATCTGTGTCCCTTTGTCAACGTCTCCACAG GTCTC

AGAAGCAGCTCACATCCCAAGTAAGAAGCCTGTGATCCCGGTTGTGAGTAGCACGGTCCTGCCGTCCACTTACCAGATCCGCATCACCACGTGCAAGACT

GAACTTCAGCAGCTCATACAGCAGAAGAGGGAGCAGTGCAACGCGGAGCGCATAGCCAAGCAGATGATGGAGAATGCCGAGTGGGAGAGCAAGCCACCTC

CACCTG GGTGGCGTCCTAAAGGGCTGCTAGTTGCACATCTTCATGAGCACAAATCTGCTGTGAATCGCATCAGAGTCTCTGATGAACACTTACTTTTTG

CAACATGTTCAAATGATGGCACAGTGAAGATCTGGAACAGCCAGAAGATGGAGGGGAAGACCACCACAACGCG GTCTATTCTCACGTACAGCCGAATTG

GAGGACGAGTCAAGACGCTAACGTTTTGCCAAGGCTCCCACTACTTGGCCATAGCATCTGATAATGGTGCTGTCCAGCTTCTTGGAATTGAGGCGTCTAA

GTTACCCAAGTCTCCTAAAATTCACCCTCTACAAAGCAG GATTCTGGATCAGAAGGAAGATGGCTGTGTGGTGGACATGCATCACTTCAACTCCGGGGC

ACAGTCCGTTCTTGCCTATGCCACGGTGAATGGCTCTCTGGTTGGATGGGATCTCAGGTCTTCAAGCAACGCGTGGACATTAAAGCATGACCTAAAGTCA

GGCCTCATCACTTCCTTTGCCGTGGACATCCACCAGTGCTGGCTGTGCATAG GCACGAGCAGCGGTGCCATGGCGTGTTGGGACATGAGGTTCCAGTTG

CCCATCTCCAGTCACTGTCATCCCTCCAGAGCTCGCATCCGGCGCCTCTCCATGCACCCCCTGTACCAGTCCTGGGTAATCGCAG CTGTTCAGGGCAAC

AATGAAGTCTCCATGTGGGACATGGAAACTGGCGACAGGAGACTGACTCTCTGGGCCAGCAGCGCACCGCCACTGTCTGAATTACAG CCTTCACCGCAC

AGCGTCCATGGCATCTACTGCAGCCCTGCAGATGGAAACCCTATCCTGCTGACCGCTGGCTCAGACATGAAAATAAG GTTCTGGGACTTGGTTTCCCCA

GAGAGGTCCTATGTTGTTGCGGGAAGTACAGGTTCCCCGTCTGTCTCCTACTACAAGAAGATAATAGAAGGCACCGAGGTCGTCCAG GAAATTCAGAAT

AAGCAGAAGGTTGGACCGAGTGATGATACCCCTCGGAGGGGCCCGGAGTCTCTGCCTGTGGGACATCATGACATCATCACAGACATTGCCACCTTCCAGA

CCACTCAGGGCTTCATTGTGACTGCTTCTAGAGACGGAATTGTGAAGGTGTGGAAATAAGTCCTGCCGACTTGTATAAAATGCTGTAAAATTCGAAATGT

ACCATAGCTCAGGACACGAAGGACTTCTAGAGAACAAACGTGGGTTTTGAAGTGACTGTTACTGTTTCATGGCTGAGCAAATCCCAGCCACAGTGGGGAA

GGATGTAGGCATGGTGACTTTCTTCATGTGCATCTCTGAAGAACTGGCCAGATAGCACAACCTGGGAGCGCTTGCTGCATATGGAACAGAACAGGTGAGA

AGTGTAAAAAGGGAAGATGACCCGGCCAGTTTATTTTCTATGGAAATGATTGTAAGCCGTTATGTAAACACACTTTTGTTATTATAAATGCTATTCAAAC

TCAAGTAAACTCTTATTCAAGCATCCTGA
Translation
 - UNI26884 - MGNQLAGIAPSQILSVESYFSDIHDFEYDKSLGSTRFFKVARAKHREGLVVVKVFAIQDPTLPLTSYKQELEELKIRLHSAQNCLP

FQKAAEKASEKAAMLFRQYVRDNLYDRISTRPFLNNIEKRWIAFQILTAVDQAHKSGVRHGDIKTENVMVTSWNWVLLTDFASFKPTYLPEDNPADFNYF

FDTSRRRTCYIAPERFVDGGMFATELEYMRDPSTPLVDLNSNQRARGELKRAMDIFSAG GCVIAELFTEGVPLFDLSQLLAYRNGHFFPEQVLNKIEDR

SIRDL VTQMINREPEKRLEAEDYLKQQRGNAFPEIFYTFLQPYMAQFAKETFLSADERILVIRKDLGNIIHNLCGHDLPEKAEGESRASGLVVLVSVIT

SCLQTLKSCDSKLAALELILHLAPRLSVEILLDRITPYLLHFSNDSVPRVRAEALRTLTKVLALVQEVPRNDVNIYPEYILPGIAHLAQDDATIVRLAYA

E ENIALLAETALRFLELVQLKTLNMENEPDNEEVDEATRPNGDYDTE ELQALHEMVQQKVVTLLSDPENIVKQTLMESGITRLCVFFGRQKANDVLLS

HMITFLNDKNDWHLRGAFFDSIVG GVAAYVGWQSSSILKPLLQQGLSDAEEFVIVKALNALTCMCQLGLLQKPHVYEFASDIA APFLCHPNLWIRYGA

VGFITVVAHQISTADVYCKLMPYLDPYITQPVIQ - UNI29679 - IERKLVLLSVLKEPVSRSIFDYALRSKDIASLFRHLHMRQKKRNGSLLDCPP

PEDPTIAQLLKKLLSQ GMTEEEEDKLLALKDFMMKSNRAKANAVDQSHLHDSSQKGVIDLAALGITGRQVDLVKTKQEPDEKRA ARKHVKQDSNVNEE

WKSMFGSLEPPNIPQALPKTSDHEVVQPGKPPRSESSAGICVPLSTSPQ VSEAAHIPSKKPVIPVVSSTVLPSTYQIRITTCKTELQQLIQQKREQCNA

ERIAKQMMENAEWESKPPPPG GWRPKGLLVAHLHEHKSAVNRIRVSDEHLLFATCSNDGTVKIWNSQKMEGKTTTTR RSILTYSRIGGRVKTLTFCQG

SHYLAIASDNGAVQLLGIEASKLPKSPKIHPLQSR RILDQKEDGCVVDMHHFNSGAQSVLAYATVNGSLVGWDLRSSSNAWTLKHDLKSGLITSFAVDI

HQCWLCIG GTSSGAMACWDMRFQLPISSHCHPSRARIRRLSMHPLYQSWVIAA AVQGNNEVSMWDMETGDRRLTLWASSAPPLSELQ PSPHSVHGIY

CSPADGNPILLTAGSDMKIR RFWDLVSPERSYVVAGSTGSPSVSYYKKIIEGTEVVQ EIQNKQKVGPSDDTPRRGPESLPVGHHDIITDIATFQTTQG

FIVTASRDGIVKVWK

For any suggestions or comments, please send an email to unitrap@crg.es