Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032575 (Armet)
Chromosomal location
Chr 9: 106791092 - 106794243 (-)
Description
arginine-rich, mutated in early stage tumors Gene [Source:MGI Symbol;Acc:MGI:1922090]
RefSeq_dna
NM_029103 
RefSeq_peptide
NP_083379.2 
UniGene
Mm.29778 Mm.471819 
MGI
MGI:1922090 
Uniprot/SWISSPROT
Q9CXI5 
Uniprot/SPTREMBL
A8C1V1 Q3TMX5 Q80ZP8 
Human Ortholog
ENSG00000145050 (ARMET)
Omim not available
UniTrap UNI10898
Vector Insertion
Chr 9: 106793530 - 106794144
Public Clones P098G08 (ggtc) W242E03 (ggtc)
Private Clones OST356500 (lexicon) OST234299 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24975
Vector Insertion
Chr 9: 106792634 - 106793401
Public Clones (sanger) PST22487-NR (escells)
Private Clones OST198962 (lexicon) OST35235 (lexicon)
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI467
Vector Insertion
Chr 9: 106791557 - 106792491
Public Clones DC0006 (sanger) DA0180 (sanger) G056D09 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000069036
Sequence
GACGGCTGAGGAGGATGTGGGCTACGCGCGGGCTGGCGGTAGCGCTGGCCCTGAGCGTGCTGCCTGACAGCCGGGCGCTGCGGCCAGGAGACTGTGAAG 

- UNI10898 - TTTGTATTTCTTATCTGGGACGATTTTACCAGGACCTCAAAGACAGAGATGTCACATTTTCACCAGCCACTATTGAAGAAGAACTTA

TAAAGTTTTGCCGTGAAGCAAGAGGCAAAGAGAATCGGTTG - UNI24975 - TGCTACTACATTGGAGCCACAGATGATGCTGCCACCAAGATCATC

AATGAGGTGTCGAAGCCCCTGGCCCACCATATCCCTGTGGAAAAGATCTGTGAGAAGCTGAAGAAGAAAGACAGCCAGATCTGTGAACTAAAATACG - 

UNI467 - ACAAGCAGATTGACCTGAGCACAGTGGACCTGAAGAAGCTCCGGGTGAAAGAGCTGAAGAAGATCCTGGACGACTGGGGGGAGATGTGCAA

AGGCTGTGCAGAAAAGTCTGACTATATCCGGAAGATAAATGAACTGATGCCTAAATACGCCCCCAAGGCAGCCAGCGCACGGACTGATCTGTAGTCTGCC

CAATTCCTGCTGCACCTGAAGGGGAAAAAGCAGTTTATCTGTCTCTTCCCCAAATAACCATTTTGTAATTTATTTTTTAAGCGGGCTCCTGACAATGAGA

TGTGAACCTAGAGCTTTCCTAGTGATGCTGGCTCTGCAGTTCCCTCTTGCCCATCCCCGAGTGGGGACAATTTCCCCATCCCCAAGTGGGGACAATTTAC

TTCCTTCTTTGCTGGTTTACTCTAGGACTTCAAAGTTTGTCTGGGATTTTTTTATTAAAAAAAATTGTCTTTGG
Translation
MWATRGLAVALALSVLPDSRALRPGDCEV - UNI10898 - VCISYLGRFYQDLKDRDVTFSPATIEEELIKFCREARGKENRL - UNI24975 - 

CYYIGATDDAATKIINEVSKPLAHHIPVEKICEKLKKKDSQICELKYD - UNI467 - DKQIDLSTVDLKKLRVKELKKILDDWGEMCKGCAEKSDYI

RKINELMPKYAPKAASARTDL

For any suggestions or comments, please send an email to unitrap@crg.es