Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032577 (Mapkapk3)
Chromosomal location
Chr 9: 107157258 - 107192208 (-)
Description
mitogen-activated protein kinase-activated protein kinase 3 Gene [Source:MGI (curated);Acc:Mapkapk3-001]
RefSeq_dna
NM_178907 
RefSeq_peptide
NP_849238.1 
UniGene
Mm.445242 
MGI
MGI:2143163 
Uniprot/SWISSPROT
Q3UMW7 
Uniprot/SPTREMBL
Q8BVC2 Q09HN3 B0QZU7 
Human Ortholog
ENSG00000114738 (MAPKAPK3)
Omim not available
UniTrap UNI4698
Vector Insertion
Chr 9: 107191503 - 107191504
Public Clones AC0061 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37244
Vector Insertion
Chr 9: 107187473 - 107191450
Public Clones CMHD-GT_473C11-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20771
Vector Insertion
Chr 9: 107166096 - 107187004
Public Clones IST15074A11 (tigm)
Private Clones OST352621 (lexicon) OST266601 (lexicon) OST67752 (lexicon)
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18469
Vector Insertion
Chr 9: 107164819 - 107165955
Public Clones CMHD-GT_330B10-3 (cmhd)
Private Clones OST422835 (lexicon)
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000068453
Sequence
ATGGATGGCGAGACAGCAGGGGAGAAGGGGAGTCTTGTGCCCCCGCCAGGTGCGCTCGGCGGGTCCGCCTTGGGTGGTGCTCCGGCCCCAGGTGTGCGAC

GGGAACCCAAGAAGTACGCGGTGACTGATGACTACCAGTTGTCCAAGCAAGTGCTGGGTCTGGGTGTGAAC - UNI4698 - CAAGGTACTGGAGTGC

TACCATCGGCGCTCTGGCCAGAAGTGTGCCCTGAAG GTCAGAAACCCAAGGGTGGGCCAGTGGCCCTGCACAGCAGAGTCCCTGGAAAGGCAAGGGTTT

CACTGACCAAAGACTGTCAACACTTAGGAAAAAAAAATACTGGAGGAGCTTCGTGGAGGTTCCTGGACTGCCAGCGCCCATCGGTTTGGCTAAACAGGTT

TCAGAAGAGCTTCCGACCTGCAAAGTGTAAAAGAAGGTTTAGATTGGGCTTGAATGTCCTGAGACTGTAATACCAGGGGCTTCTCAAAATTTTTTTCCCA

CTTTGCTGGAGAAAGTTTGACACTTCTCTGGGTCTATAGATATATAAAATAGTATACAGCCCATACATTTGCTGGTAGTAAAATTATAAGACATTTATTT

TAAAATAACTCTTTGTCATAGCTACATTATGACTAGTTATCAAAGATGAAAGCAAGATTTCATATTAATGAAATAAACGTGCCTGTTTATTTTTTGATGT

AAAGG
Translation
MDGETAGEKGSLVPPPGALGGSALGGAPAPGVRREPKKYAVTDDYQLSKQVLGLGVN - UNI4698 - QGTGVLPSALWPEVCPEG GQKPKGGPVAL

HSRVPGKARVSLTKDCQHLGKKNTGGASWRFLDCQRPSVWLNRFQKSFRPAKCKRRFRLGLNVLRL
Transcript ENSMUST00000112434
Sequence
GCCCTGGCCTGCCCAACCCGGACTAGCCTGGCCCTTTAAGGTTGACCTAGCGGGGCCCCAAGTCTGAATGACGCGACGAGAAGCGGGGGTGGGGGGTCAC

GTGGGACGCGGGCGGCGAGACTCTGGGTCCAGGGCTCCGGTCCTCAGCGGACTCCAGGGATCACTATCTCTTGCCCACTCTCGCCTGCACCATGATTTTC

GTGTAGTGCTTTGCCACCAAGTGCGCCTTCGCCTGGTCCGCCTTTCTTGGGTCTCTGTATGGCTGGTTCTCAAGACCTTGTTGCTATACAGCGCCGGACT

CCTTCCTAATTTGACACGTGCCTGGGCTGAGGGATCACCTCCCCCTGCTGTAC GTGCCTCTGGACGCGCCAGGCTGGGGCTACCTCCGAGCGCCCCGTG

GGGGCCATGGATGGCGAGACAGCAGGGGAGAAGGGGAGTCTTGTGCCCCCGCCAGGTGCGCTCGGCGGGTCCGCCTTGGGTGGTGCTCCGGCCCCAGGTG

TGCGACGGGAACCCAAGAAGTACGCGGTGACTGATGACTACCAGTTGTCCAAGCAAGTGCTGGGTCTGGGTGTGAACGGCAAGGTACTGGAGTGCTACCA

TCGGCGCTCTGGCCAGAAGTGTGCCCTGAAG - UNI20771 - CTCCTGTATGACAGCCCCAAGGCCCGGCAGGAGGTGGACCACCACTGGCAGGCGT

CAGGCGGCCCCCACATCGTGCGCATCCTGGACGTGTATGAGAATATGCACCACGGCAAGCGCTGTCTCCTCATTGTCATGGAATG - UNI18469 - C

ATGGAGGGTGGTGAGCTGTTCAGCAGGATTCAGGAGCGTGGTGACCAGGCTTTCACTGAGAGAG AGGCTGCAGAGATAATGCGGGACATTGGCACTGCC

ATCCAGTTCTTGCACAGCCGGAACATTGCCCACCGAGATGTCAAG CCTGAAAACCTACTCTATACATCCAAGGAGAAGGATGCTGTACTTAAACTCACC

GATTTTGGCTTTGCCAAGGAAACCACCCAAAATGCCCTCCAGACACCCTGCTACACTCCCTATTATGTGG CTCCTGAGGTCCTGGGTCCAGAGAAGTAT

GACAAGTCCTGTGATATGTGGTCCCTGGGCGTCATCATGTACATCCT CAATCCATGGTGGTCCCACAGACCCCACTCTACACAGCCCGAGTGCTCCAGG

AAGACAAAGATCACTGGGATGACGTCAAG GAAGAGATGACCAGTGCCCTGGCCACTATGCGGGTAGACTATGACCAGGTGAAGATCAAGGACCTGAAGA

CCTCTAACAACCGGCTCCTCAACAAGAGGAGGAAAAAGCAGGCAGGCAGCTCCTCAGCCTCACAAGGATGCAACAACCAGTAACTCATGGTGCCTTGGAG

AAGCCAGGCTGACAGACTGTAATGTCCTGAGGCTCTGGCCAGGAGGGGCTGGAGTCGTTCTTATAACAAAAGGACAATTTTGTTGTCTTATGTGTCACAT

TGAACTTGGGGATAAAGAGCTTGGCCCAAGAATCCCAGCCTAAGTCTCAGGCTCTAGCAAGCTGCAGGTGACAGGGATGGGAGCCCTCTGCGACAGCTGG

AGCAACTTTGCACACCAGCTTGACTGAGGCCACAGCTCTGTTCTGCCTCAGGAAGCAGCCTTACTTCTAGGCCACTGGGTGTTGTGGCGGATATACCCGT

TTTTCTATAAAGGATGTGTCCTGCTGTGTGGGCAGATGGGTCTGGCCTTGAGGAAGGTATTGGGCCATTGGTTGCTATGGTGACCAGAGGCCATGTTGCT

GTCTGAGAATACTGAACACAGGAGGAAGGAGGGACAATCAAGGGTCTACCTTCTTGGGGAGGTCTGTCTCTCTCACACTGGATGTCCCTCCCCAGGCTCT

CTCCTCTGGTCTGCTAGAGGCTGCAGAGTCCTGATTGCTTGCTTTCCTGGGTGGTCCAGCCCTGCCTTACTGTAGCAAGAGCCCATGTAACACTCAGAGA

GCCACTAGAGTCCCTGGGCCAAGCATCCTCTCCATTACCCCCTGATCCAAAAGGTAACTTCTCATCTCAACTGAAGGTGTGGATATGTATGTTGGGGGTG

GGTATCCTTAACCTTTTTCCAGTTTGGAAACCTCACTGTGACAAAAGCCCCCACCTCTTCCTGCTCACCAGATCTCAGGTAGGAAAGCCAGTCTCTGCTG

ACAGCACGGGATCTCAGGTAGGAAAGTCCGTCTCTGCTGACAGCACGGGCAACCTTGGGACTTACTTTTGTGAAAGGTCGCACTTGGCTCCCTGTTTGTT

ATCTAGGACCTTTTCTGGTACTCTGGATCAGACCTGGCTGGTGAAGGGCTGCTGAGCCGTGCTTACAAGGTCTGGTCCTGGCTTTAGCAGAATTGGAGCA

GAGAGGGTTTTCCTTGGCTGATCCCAGACTTAGCCAGCTCTGCCCTGTCCTGCCCAGGGCAGCATCCAGGTGCTGAGTGGTTGATTGGTGACCTGACAAG

TGCCTGGCACCCAGCCTACTTCCTAGATCCTAGATCCTGGCCCTTCTCACTGGCTGGGAAACCTTAGATCTTATCAATTACAATGCTGCTGGGTTTTATA

TTCTGATATCAATAAACACATTTTTAACATTTTTCAATG
Translation
 MDGETAGEKGSLVPPPGALGGSALGGAPAPGVRREPKKYAVTDDYQLSKQVLGLGVNGKVLECYHRRSGQKCALK - UNI20771 - LLYDSPKARQ

EVDHHWQASGGPHIVRILDVYENMHHGKRCLLIVMEC - UNI18469 - CMEGGELFSRIQERGDQAFTERE EAAEIMRDIGTAIQFLHSRNIAHRD

VK PENLLYTSKEKDAVLKLTDFGFAKETTQNALQTPCYTPYYVA APEVLGPEKYDKSCDMWSLGVIMYIL LNPWWSHRPHSTQPECSRKTKITGMTS

R RKR
Transcript ENSMUST00000035194
Sequence
GCCCTGGCCTGCCCAACCCGGACTAGCCTGGCCCTTTAAGGTTGACCTAGCGGGGCCCCAAGTCTGAATGACGCGACGAGAAGCGGGGGTGGGGGGTCAC

GTGGGACGCGGGCGGCGAGACTCTGGGTCCAGGGCTCCGGTCCTCAGCGGACTCCAGGGATCACTATCTCTTGCCCACTCTCGCCTGCACCATGATTTTC

GTGTAGTGCTTTGCCACCAAGTGCGCCTTCGCCTGGTCCGCCTTTCTTGGGTCTCTGTATGGCTGGTTCTCAAGACCTTGTTGCTATACAGCGCCGGACT

CCTTCCTAATTTGACACGTGCCTGGGCTGAGGGATCACCTCCCCCTGCTGTAC GTGCCTCTGGACGCGCCAGGCTGGGGCTACCTCCGAGCGCCCCGTG

GGGGCCATGGATGGCGAGACAGCAGGGGAGAAGGGGAGTCTTGTGCCCCCGCCAGGTGCGCTCGGCGGGTCCGCCTTGGGTGGTGCTCCGGCCCCAGGTG

TGCGACGGGAACCCAAGAAGTACGCGGTGACTGATGACTACCAGTTGTCCAAGCAAGTGCTGGGTCTGGGTGTGAACGGCAAGGTACTGGAGTGCTACCA

TCGGCGCTCTGGCCAGAAGTGTGCCCTGAAG - UNI20771 - CTCCTGTATGACAGCCCCAAGGCCCGGCAGGAGGTGGACCACCACTGGCAGGCGT

CAGGCGGCCCCCACATCGTGCGCATCCTGGACGTGTATGAGAATATGCACCACGGCAAGCGCTGTCTCCTCATTGTCATGGAATG - UNI18469 - C

ATGGAGGGTGGTGAGCTGTTCAGCAGGATTCAGGAGCGTGGTGACCAGGCTTTCACTGAGAGAG AGGCTGCAGAGATAATGCGGGACATTGGCACTGCC

ATCCAGTTCTTGCACAGCCGGAACATTGCCCACCGAGATGTCAAG CCTGAAAACCTACTCTATACATCCAAGGAGAAGGATGCTGTACTTAAACTCACC

GATTTTGGCTTTGCCAAGGAAACCACCCAAAATGCCCTCCAGACACCCTGCTACACTCCCTATTATGTGG CTCCTGAGGTCCTGGGTCCAGAGAAGTAT

GACAAGTCCTGTGATATGTGGTCCCTGGGCGTCATCATGTACATCCT TTTGTGTGGATTCCCACCCTTCTACTCCAACACCGGCCAGGCCATCTCTCCA

GGAATGAAAAGAAGGATTCGCTTGGGCCAGTATAGCTTCCCTAACCCTGAATGGTTAGATGTCTCTGAGGATG CCAAGCAGCTAATCCGCCTGCTCCTG

AAGACAGATCCCACAGAGAGGCTAACGATCATGCAGTTTATGAACCATCCTTGGATCAAT CAATCCATGGTGGTCCCACAGACCCCACTCTACACAGCC

CGAGTGCTCCAGGAAGACAAAGATCACTGGGATGACGTCAAG GAAGAGATGACCAGTGCCCTGGCCACTATGCGGGTAGACTATGACCAGGTGAAGATC

AAGGACCTGAAGACCTCTAACAACCGGCTCCTCAACAAGAGGAGGAAAAAGCAGGCAGGCAGCTCCTCAGCCTCACAAGGATGCAACAACCAGTAACTCA

TGGTGCCTTGGAGAAGCCAGGCTGACAGACTGTAATGTCCTGAGGCTCTGGCCAGGAGGGGCTGGAGTCGTTCTTATAACAAAAGGACAATTTTGTTGTC

TTATGTGTCACATTGAACTTGGGGATAAAGAGCTTGGCCCAAGAATCCCAGCCTAAGTCTCAGGCTCTAGCAAGCTGCAGGTGACAGGGATGGGAGCCCT

CTGCGACAGCTGGAGCAACTTTGCACACCAGCTTGACTGAGGCCACAGCTCTGTTCTGCCTCAGGAAGCAGCCTTACTTCTAGGCCACTGGGTGTTGTGG

CGGATATACCCGTTTTTCTATAAAGGATGTGTCCTGCTGTGTGGGCAGATGGGTCTGGCCTTGAGGAAGGTATTGGGCCATTGGTTGCTATGGTGACCAG

AGGCCATGTTGCTGTCTGAGAATACTGAACACAGGAGGAAGGAGGGACAATCAAGGGTCTACCTTCTTGGGGAGGTCTGTCTCTCTCACACTGGATGTCC

CTCCCCAGGCTCTCTCCTCTGGTCTGCTAGAGGCTGCAGAGTCCTGATTGCTTGCTTTCCTGGGTGGTCCAGCCCTGCCTTACTGTAGCAAGAGCCCATG

TAACACTCAGAGAGCCACTAGAGTCCCTGGGCCAAGCATCCTCTCCATTACCCCCTGATCCAAAAGGTAACTTCTCATCTCAACTGAAGGTGTGGATATG

TATGTTGGGGGTGGGTATCCTTAACCTTTTTCCAGTTTGGAAACCTCACTGTGACAAAAGCCCCCACCTCTTCCTGCTCACCAGATCTCAGGTAGGAAAG

CCAGTCTCTGCTGACAGCACGGGATCTCAGGTAGGAAAGTCCGTCTCTGCTGACAGCACGGGCAACCTTGGGACTTACTTTTGTGAAAGGTCGCACTTGG

CTCCCTGTTTGTTATCTAGGACCTTTTCTGGTACTCTGGATCAGACCTGGCTGGTGAAGGGCTGCTGAGCCGTGCTTACAAGGTCTGGTCCTGGCTTTAG

CAGAATTGGAGCAGAGAGGGTTTTCCTTGGCTGATCCCAGACTTAGCCAGCTCTGCCCTGTCCTGCCCAGGGCAGCATCCAGGTGCTGAGTGGTTGATTG

GTGACCTGACAAGTGCCTGGCACCCAGCCTACTTCCTAGATCCTAGATCCTGGCCCTTCTCACTGGCTGGGAAACCTTAGATCTTATCAATTACAATGCT

GCTGGGTTTTATATTCTGATATCAATAAACACATTTTTAACATTTTTCAATG
Translation
 MDGETAGEKGSLVPPPGALGGSALGGAPAPGVRREPKKYAVTDDYQLSKQVLGLGVNGKVLECYHRRSGQKCALK - UNI20771 - LLYDSPKARQ

EVDHHWQASGGPHIVRILDVYENMHHGKRCLLIVMEC - UNI18469 - CMEGGELFSRIQERGDQAFTERE EAAEIMRDIGTAIQFLHSRNIAHRD

VK PENLLYTSKEKDAVLKLTDFGFAKETTQNALQTPCYTPYYVA APEVLGPEKYDKSCDMWSLGVIMYIL LLCGFPPFYSNTGQAISPGMKRRIRLG

QYSFPNPEWLDVSEDA AKQLIRLLLKTDPTERLTIMQFMNHPWIN QSMVVPQTPLYTARVLQEDKDHWDDVK EEMTSALATMRVDYDQVKIKDLKTS

NNRLLNKRRKKQAGSSSASQGCNNQ

For any suggestions or comments, please send an email to unitrap@crg.es