Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032582 (Rbm6)
Chromosomal location
Chr 9: 107675896 - 107775152 (-)
Description
RNA binding motif protein 6 Gene [Source:MGI Symbol;Acc:MGI:1338037]
RefSeq_dna
NM_029169 
RefSeq_peptide
NP_035381.2 NP_083445.1 
UniGene
Mm.139926 
MGI
MGI:1338037 
Uniprot/SPTREMBL
O88720 Q3TPF1 Q3ULB0 Q5DTS4 Q8R388 Q9CRY1 
Human Ortholog
ENSG00000004534 (RBM6)
Omim not available
UniTrap UNI20783
Vector Insertion
Chr 9: 107762791 - 107774979
Public Clones IST11387C2 (tigm)
Private Clones OST352315 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30271
Vector Insertion
Chr 9: 107754455 - 107762791
Public Clones D051G03 (ggtc) D051F03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8469
Vector Insertion
Chr 9: 107753336 - 107754455
Public Clones RRQ119 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI757
Vector Insertion
Chr 9: 107703105 - 107735764
Public Clones CJ0151 (sanger) RRR100 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10043
Vector Insertion
Chr 9: 107694350 - 107698807
Public Clones XC335 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33166
Vector Insertion
Chr 9: 107693335 - 107694350
Public Clones IST14827E7 (tigm) IST13966E7 (tigm) IST14827G7 (tigm) IST10247C12 (tigm)
IST14805C6 (tigm) IST11058H9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19005
Vector Insertion
Chr 9: 107690704 - 107691938
Public Clones not available
Private Clones OST407195 (lexicon)
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3952
Vector Insertion
Chr 9: 107681980 - 107684940
Public Clones AS0508 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8886
Vector Insertion
Chr 9: 107680359 - 107681904
Public Clones XL018 (baygenomics) XL002 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26506
Vector Insertion
Chr 9: 107676139 - 107676922
Public Clones not available
Private Clones OST113948 (lexicon) OST18492 (lexicon)
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112323
Sequence
GCGGGATTTGCGGCCGTACTTCATCTCCCGGCGGGCCCAGCGCTGAAGGCGGTGGCGCGACGCCTTTGTGGAAGCCGGAGCCCACCGGGAGGAAGTTCCG

GTCTCCGGGACGCTGGGTCCGTGGCGGCCTCTGAGGAGGAGGAGAAGCGGGCCGCGGCGGCTACGCTGCTTTG - UNI20783 - - UNI30271 - 

GTACCACCGTGCTAGAGTTTGGTAGGAAAAAGATCTACTTATTGAAGCTTTCTTGACATAGAAAGAGATGTGGGGGGATTCTCGATCTGCTAACAGAACA

GGACCTTTTCG - UNI30271 - TGGGAGCCAAGAAGAAAGGTTTGCTCCCGGGTGGAACAGGGATTATCCTCCTCCTCCCCTTAAGAGTCATGCTCA

AGAGAGACACTCTGGCAACTTTCCTGGCAGAGATTCACTTCCCTTTGATTTCCAGGGGCATTCAGGACCTCCCTTTGCAAATGTAGAGGAGCATTCTTTC

AGCTATGGAGGTAGAGATGGACCACATGGTGACTATCAAGGAGGGGAGGGACCTGGACACGATTTCAGAGGGGGAGATTTTTCATCTTCGGATTTCCAGA

GTAGAGATTCAGCACAGTTGGACTTCAGGAACAGGGACATACATTCTGGGGATTTTCGGGATAGAGAAGGACCACCTATGGACTACAGGGGTGGAGATGG

TACTCCTATGGATTATAGAGGTAGGGAGACACCTCATATGAATTATAGAGACAGGGATTCTCATACTGTTGACTTTAGAAGTAGAGATGTCCCTCCAACT

GACTTTAGGGGGCGGGGCACATATGATTTAGATTTTAGAGGCCGAGAGGGATCCCATTCAGATTTTAGGGGAAGAGATTTATCAGATTTGGATTTTAGAT

CCAGAGATCAGTCTCGTTCTGATTTTAGGAACAGAGATGTATCTGATTTGGACTTCAGGGATAAAGATGGAACACAGGTGGACTTTAGAGGCCGAGGTTC

AGCTACTACTGATCTAGACTTTAGGAACAGGGATACACCACATTCGGATTTCAGAGGTAGACATCGTACTAGGACTTACCAAGATTTTCGGGGCAGAGAG

GTAGGACCTTGTATGGAATTTAAAGATAGGGAGATGCCTCCTATGGATCCAAAAGTTTTGGATTACATTCAGCCTTCTCCACAAGAGAGAGAACATTCTG

GTATGAATATGAACAAGAGAGAAGAATCCATACATGACCATGCAATGGAAAGACCTGCTTTTGGTGTTCAGAAGGGAGAATTTGAGCATTCAGAAACAAG

AGAAGGAGAAACACAAAGTGGAACTTTTGAACATGAATCTCAATCAGACTTTCAAAACAGCCAAAGTCCAGTTCAAGAACAAGATAAGCCAAAGCTTTCT

GGAGGTGAACAACAGAGTTCAGATGCTGGTCTGTTTAAAGAAGAAGGTGATTTGGACTTTCTTGGCCAACAAGACACTGATTACAGAAGCATTGAATACT

GTGATGTGGATCACAGGTTGCCAGGAAACCAGATTTTTGGCTATGGCCAGAGCAAGTCATTTTCTCAGGGCAAAATGTCCAGAGATGCCCAACAAGACCT

TCAG - UNI8469 - - UNI30271 - GATCAAGATTATAGGACTGGCCCAAGCGAGGAGAAACCTAACAGGCTTATTCGATTAAGTGGGGTTCCAG

AAAATGCCACAAAAGAAGAG ATTCTTAATGCCTTTCGAACTTCTGATGGCATACCTGTAAAGGACTTGCAGTTGAAGGAGTATAACACAG GTTACGAC

TATGGCTATGTCTGCGTGGAATTTTCACTCTTGGAAGATGCCATCGGATGCATGGAGGCCAACCAG - UNI757 - GGAACTCTAATGATCCATGACA

AAGAGGTCACTCTTGAGTATGTACCAAGCCCAGATTTTTGGTACTGTAAACGA TGTAAGGCTAGCACTGGTGGGCATCAGTCTTCTTGTTCATTCTGCA

AGGGCCCAAAGGAAG - UNI10043 - - UNI33166 - AAGTCAAGCAGGAACTAGTGTCCTATCCTCAACCTCAGAAAACATCCATACCAGTACC

TTCAGAAAAACAGCCCAACCAGCCACGACCTGCTGATAAGGAGCATGAACTCAGGAAACGGGAGGAAGGCCAAGAGTCAAGATTAGGACATCAGAAGAGA

GATACAGAAAGATACTTCCCTCACTCTCGAAGGGAAGGGCTTACTTTCCGAAGAGACCGGGAAAAGGAGCCATGGTCTGGAGATTCACGCCAGGATGGGG

AGAGTAAAA - UNI33166 - CAATCATGCTAAAGCGTATCTATCGTTCCACTCCACCCGAAGTGATAGTCGAAGTGCTGGAGCCCTACGTGCATCTC

ACTACTGCCAATGTCCGCATCATCAAGAACAGGACTGGCCCCATGGGTCACACTTACGGTTTTATAGACCTTGACTCCCATGCA - UNI33166 - GA

AGCTCTTCGAGTAGTGAAGATTTTGCAGAACCTTGATCCACCATTTAGCATTGATGGGAAGATGGTAGCTGTAAACCTGGCCACTGGAAAACGAAG - U

NI19005 - AAATGATTCTGGGGACCATTCTGACCACATGCATTACTATCAG GGTAAAAAATATTTTCGAGATAGGAGAGGAGGAAACAGAAATTCAG

ACTGGTCTTCAGATACAAATCGACAAGGGCAACAGT CATCATCTGACTGCTACATATATGATTCTACTACTGGCTACTATTATGACCCCTTGGCAGGAA

CTTACTATGATCCCAACACCCAG CAAGAAGTCTATGTGCCCCAGGACCCTGAGTCACCTGATGAAGAAGAAATCAAGGAAAAGAAATCTACCAGTCAAG

GAAAGTCAAATAGCAAGAAAGAAACATCTAAAAGAGATGGCAAGGAGAAAAAAGACAGAGGAATGACAAAG TTTCAAGAAAGTACCAGTGAGGGGAAGC

CTCCCCTAGAAGATGTTTTTAAGAAGCCTCTACCTCCTACTGTGAAAAAGGAAGAGAGTCCTCCTCCA CCTAAGGTGGTAAATCCACTGATTGGTCTCC

TGGGTGAATATGGAGGAGACAGTGACTATGAGGAAGAGGAAGAAGAGGAACAGGCTCCTCCTGTGCAGCCTCGCACAGCACAGCCTCGCGAGGAAATGAC

CAAGAAAGAGAATGAAGACGACAAACTCACTGACTGGAATAAACTGGCTTGTCTGCTCTGCAGAAGGCAGTTTCCCAATAAAGAAGTTCTTACGAAACAC

CAACAACTGTCCGACCTGCACAAG - UNI3952 - CAAAACCTGGAAATTCACCGGAAGATAAAACAGTCAGAGCAAGAGCTCGCCTATCTGGAGAGG

AGAGAGCGGGAG - UNI8886 - GGAAGGTTTAAAGAAAAAGGAAATGACCGAAGGGAAAAACTACAATCTTTTGATTCTCCAGAAAGGAAACGGATT

AAATACTCCAGAGAAACAGACAG TGATCGTAACCCTGTTGATAAAGAAGACACTGACACTAGTAGCAAAGGAGGCTGTGCCCAGCAGGCCACTGGCTGG

AGGAAAGGGGCGGGCCTGGGATATAGCCATCCTGGATTGGGTTCATCAGAGGAG - UNI26506 - ATTGAAGGGCGGATGAGGGGACCTGGGGGTGG

TCCCCCAGGAAGAACCAGCAAGAGACAGTCTAATGAGACTTACCGAGACGCTGTTCGAAGAGTCATGTTTGCTCGATATAAAGAACTCGATTAAGAGTGG

AGACACCCCGCAGGACACAATTTCCTCTTTGTTTTGTTTGTCCTTTTCTCCTTTTGTTTTGTTACTGTTCTTGCTGCTAGAACTTTTTTAAATAAACTTT

TTTTCAATGTG
Translation
 - UNI20783 - - UNI30271 -  - UNI30271 - MDYRGGDGTPMDYRGRETPHMNYRDRDSHTVDFRSRDVPPTDFRGRGTYDLDFRGREGS

HSDFRGRDLSDLDFRSRDQSRSDFRNRDVSDLDFRDKDGTQVDFRGRGSATTDLDFRNRDTPHSDFRGRHRTRTYQDFRGREVGPCMEFKDREMPPMDPK

VLDYIQPSPQEREHSGMNMNKREESIHDHAMERPAFGVQKGEFEHSETREGETQSGTFEHESQSDFQNSQSPVQEQDKPKLSGGEQQSSDAGLFKEEGDL

DFLGQQDTDYRSIEYCDVDHRLPGNQIFGYGQSKSFSQGKMSRDAQQDLQ - UNI8469 - - UNI30271 - DQDYRTGPSEEKPNRLIRLSGVPE

NATKEE ILNAFRTSDGIPVKDLQLKEYNTG GYDYGYVCVEFSLLEDAIGCMEANQ - UNI757 - GTLMIHDKEVTLEYVPSPDFWYCKR CKAST

GGHQSSCSFCKGPKEE - UNI10043 - - UNI33166 - EVKQELVSYPQPQKTSIPVPSEKQPNQPRPADKEHELRKREEGQESRLGHQKRDTER

YFPHSRREGLTFRRDREKEPWSGDSRQDGESKT - UNI33166 - TIMLKRIYRSTPPEVIVEVLEPYVHLTTANVRIIKNRTGPMGHTYGFIDLDSH

A - UNI33166 - EALRVVKILQNLDPPFSIDGKMVAVNLATGKRR - UNI19005 - RNDSGDHSDHMHYYQ GKKYFRDRRGGNRNSDWSSDTN

RQGQQS SSSDCYIYDSTTGYYYDPLAGTYYDPNTQ QEVYVPQDPESPDEEEIKEKKSTSQGKSNSKKETSKRDGKEKKDRGMTK FQESTSEGKPPLE

DVFKKPLPPTVKKEESPPP PKVVNPLIGLLGEYGGDSDYEEEEEEEQAPPVQPRTAQPREEMTKKENEDDKLTDWNKLACLLCRRQFPNKEVLTKHQQL

SDLHK - UNI3952 - QNLEIHRKIKQSEQELAYLERRERE - UNI8886 - GRFKEKGNDRREKLQSFDSPERKRIKYSRETDS SDRNPVDKED

TDTSSKGGCAQQATGWRKGAGLGYSHPGLGSSEE - UNI26506 - IEGRMRGPGGGPPGRTSKRQSNETYRDAVRRVMFARYKELD
Transcript ENSMUST00000035201
Sequence
GGGTCCGTGGCGGCCTCTGAGGAGGAGGAGAAGCGGGCCGCGGCGGCTACGCTGCTTTG - UNI20783 - - UNI30271 - GTACCACCGTGCTA

GAGTTTGGTAGGAAAAAGATCTACTTATTGAAGCTTTCTTGACATAGAAAGAGATGTGGGGGGATTCTCGATCTGCTAACAGAACAGGACCTTTTCG - 

UNI30271 - GACTGGGTGAAAGCTTTTTCTGCAGCAGTCATGTTGAAAACCTTGTGTTGACTTACCTCGTGTTCTGAAATGGGAGCATAAAAGTTTAC

TCGGACACCTCATCTTAAAATAGCAAAACTTGCTGTTTTCTGCAGATCTAGGACCTTGTTACAGAACTCTGCCCCCCAAAATATGTTTACAGAAGAATAT

GCTGTGATTAGAGAAGAATATGCTGGTGTGTAGATTTCAAACTCTCTGGACAATATGAATAACCCTGTCTTTGTTTCTACAGTGGGAGCCAAGAAGAAAG

GTTTGCTCCCGGGTGGAACAGGGATTATCCTCCTCCTCCCCTTAAGAGTCATGCTCAAGAGAGACACTCTGGCAACTTTCCTGGCAGAGATTCACTTCCC

TTTGATTTCCAGGGGCATTCAGGACCTCCCTTTGCAAATGTAGAGGAGCATTCTTTCAGCTATGGAGGTAGAGATGGACCACATGGTGACTATCAAGGAG

GGGAGGGACCTGGACACGATTTCAGAGGGGGAGATTTTTCATCTTCGGATTTCCAGAGTAGAGATTCAGCACAGTTGGACTTCAGGAACAGGGACATACA

TTCTGGGGATTTTCGGGATAGAGAAGGACCACCTATGGACTACAGGGGTGGAGATGGTACTCCTATGGATTATAGAGGTAGGGAGACACCTCATATGAAT

TATAGAGACAGGGATTCTCATACTGTTGACTTTAGAAGTAGAGATGTCCCTCCAACTGACTTTAGGGGGCGGGGCACATATGATTTAGATTTTAGAGGCC

GAGAGGGATCCCATTCAGATTTTAGGGGAAGAGATTTATCAGATTTGGATTTTAGATCCAGAGATCAGTCTCGTTCTGATTTTAGGAACAGAGATGTATC

TGATTTGGACTTCAGGGATAAAGATGGAACACAGGTGGACTTTAGAGGCCGAGGTTCAGCTACTACTGATCTAGACTTTAGGAACAGGGATACACCACAT

TCGGATTTCAGAGGTAGACATCGTACTAGGACTTACCAAGATTTTCGGGGCAGAGAGGTAGGACCTTGTATGGAATTTAAAGATAGGGAGATGCCTCCTA

TGGATCCAAAAGTTTTGGATTACATTCAGCCTTCTCCACAAGAGAGAGAACATTCTGGTATGAATATGAACAAGAGAGAAGAATCCATACATGACCATGC

AATGGAAAGACCTGCTTTTGGTGTTCAGAAGGGAGAATTTGAGCATTCAGAAACAAGAGAAGGAGAAACACAAAGTGGAACTTTTGAACATGAATCTCAA

TCAGACTTTCAAAACAGCCAAAGTCCAGTTCAAGAACAAGATAAGCCAAAGCTTTCTGGAGGTGAACAACAGAGTTCAGATGCTGGTCTGTTTAAAGAAG

AAGGTGATTTGGACTTTCTTGGCCAACAAGACACTGATTACAGAAGCATTGAATACTGTGATGTGGATCACAGGTTGCCAGGAAACCAGATTTTTGGCTA

TGGCCAGAGCAAGTCATTTTCTCAGGGCAAAATGTCCAGAGATGCCCAACAAGACCTTCAG - UNI8469 - - UNI30271 - GATCAAGATTATA

GGACTGGCCCAAGCGAGGAGAAACCTAACAGGCTTATTCGATTAAGTGGGGTTCCAGAAAATGCCACAAAAGAAGAG ATTCTTAATGCCTTTCGAACTT

CTGATGGCATACCTGTAAAGGACTTGCAGTTGAAGGAGTATAACACAG GTTACGACTATGGCTATGTCTGCGTGGAATTTTCACTCTTGGAAGATGCCA

TCGGATGCATGGAGGCCAACCAG - UNI757 - GGAACTCTAATGATCCATGACAAAGAGGTCACTCTTGAGTATGTACCAAGCCCAGATTTTTGGTA

CTGTAAACGA TGTAAGGCTAGCACTGGTGGGCATCAGTCTTCTTGTTCATTCTGCAAGGGCCCAAAGGAAG - UNI10043 - - UNI33166 - A

AGTCAAGCAGGAACTAGTGTCCTATCCTCAACCTCAGAAAACATCCATACCAGTACCTTCAGAAAAACAGCCCAACCAGCCACGACCTGCTGATAAGGAG

CATGAACTCAGGAAACGGGAGGAAGGCCAAGAGTCAAGATTAGGACATCAGAAGAGAGATACAGAAAGATACTTCCCTCACTCTCGAAGGGAAGGGCTTA

CTTTCCGAAGAGACCGGGAAAAGGAGCCATGGTCTGGAGATTCACGCCAGGATGGGGAGAGTAAAA - UNI33166 - CAATCATGCTAAAGCGTATC

TATCGTTCCACTCCACCCGAAGTGATAGTCGAAGTGCTGGAGCCCTACGTGCATCTCACTACTGCCAATGTCCGCATCATCAAGAACAGGACTGGCCCCA

TGGGTCACACTTACGGTTTTATAGACCTTGACTCCCATGCA - UNI33166 - GAAGCTCTTCGAGTAGTGAAGATTTTGCAGAACCTTGATCCACCA

TTTAGCATTGATGGGAAGATGGTAGCTGTAAACCTGGCCACTGGAAAACGAAG - UNI19005 - AAATGATTCTGGGGACCATTCTGACCACATGCA

TTACTATCAG GGTAAAAAATATTTTCGAGATAGGAGAGGAGGAAACAGAAATTCAGACTGGTCTTCAGATACAAATCGACAAGGGCAACAGT CATCAT

CTGACTGCTACATATATGATTCTACTACTGGCTACTATTATGACCCCTTGGCAGGAACTTACTATGATCCCAACACCCAG CAAGAAGTCTATGTGCCCC

AGGACCCTGAGTCACCTGATGAAGAAGAAATCAAGGAAAAGAAATCTACCAGTCAAGGAAAGTCAAATAGCAAGAAAGAAACATCTAAAAGAGATGGCAA

GGAGAAAAAAGACAGAGGAATGACAAAG TTTCAAGAAAGTACCAGTGAGGGGAAGCCTCCCCTAGAAGATGTTTTTAAGAAGCCTCTACCTCCTACTGT

GAAAAAGGAAGAGAGTCCTCCTCCA CCTAAGGTGGTAAATCCACTGATTGGTCTCCTGGGTGAATATGGAGGAGACAGTGACTATGAGGAAGAGGAAGA

AGAGGAACAGGCTCCTCCTGTGCAGCCTCGCACAGCACAGCCTCGCGAGGAAATGACCAAGAAAGAGAATGAAGACGACAAACTCACTGACTGGAATAAA

CTGGCTTGTCTGCTCTGCAGAAGGCAGTTTCCCAATAAAGAAGTTCTTACGAAACACCAACAACTGTCCGACCTGCACAAG - UNI3952 - CAAAAC

CTGGAAATTCACCGGAAGATAAAACAGTCAGAGCAAGAGCTCGCCTATCTGGAGAGGAGAGAGCGGGAG - UNI8886 - GGAAGGTTTAAAGAAAAA

GGAAATGACCGAAGGGAAAAACTACAATCTTTTGATTCTCCAGAAAGGAAACGGATTAAATACTCCAGAGAAACAGACAG TGATCGTAACCCTGTTGAT

AAAGAAGACACTGACACTAGTAGCAAAGGAGGCTGTGCCCAGCAGGCCACTGGCTGGAGGAAAGGGGCGGGCCTGGGATATAGCCATCCTGGATTGGGTT

CATCAGAGGAG - UNI26506 - ATTGAAGGGCGGATGAGGGGACCTGGGGGTGGTCCCCCAGGAAGAACCAGCAAGAGACAGTCTAATGAGACTTAC

CGAGACGCTGTTCGAAGAGTCATGTTTGCTCGATATAAAGAACTCGATTAAGAGTGGAGACACCCCGCAGGACACAATTTCCTCTTTGTTTTGTTTGTCC

TTTTCTCCTTTTGTTTTGTTACTGTTCTTGCTGCTAGAACTTTTTTAAATAAACTTTTTTTCAATGTG
Translation
 - UNI20783 - - UNI30271 -  - UNI30271 - MDYRGGDGTPMDYRGRETPHMNYRDRDSHTVDFRSRDVPPTDFRGRGTYDLDFRGREGS

HSDFRGRDLSDLDFRSRDQSRSDFRNRDVSDLDFRDKDGTQVDFRGRGSATTDLDFRNRDTPHSDFRGRHRTRTYQDFRGREVGPCMEFKDREMPPMDPK

VLDYIQPSPQEREHSGMNMNKREESIHDHAMERPAFGVQKGEFEHSETREGETQSGTFEHESQSDFQNSQSPVQEQDKPKLSGGEQQSSDAGLFKEEGDL

DFLGQQDTDYRSIEYCDVDHRLPGNQIFGYGQSKSFSQGKMSRDAQQDLQ - UNI8469 - - UNI30271 - DQDYRTGPSEEKPNRLIRLSGVPE

NATKEE ILNAFRTSDGIPVKDLQLKEYNTG GYDYGYVCVEFSLLEDAIGCMEANQ - UNI757 - GTLMIHDKEVTLEYVPSPDFWYCKR CKAST

GGHQSSCSFCKGPKEE - UNI10043 - - UNI33166 - EVKQELVSYPQPQKTSIPVPSEKQPNQPRPADKEHELRKREEGQESRLGHQKRDTER

YFPHSRREGLTFRRDREKEPWSGDSRQDGESKT - UNI33166 - TIMLKRIYRSTPPEVIVEVLEPYVHLTTANVRIIKNRTGPMGHTYGFIDLDSH

A - UNI33166 - EALRVVKILQNLDPPFSIDGKMVAVNLATGKRR - UNI19005 - RNDSGDHSDHMHYYQ GKKYFRDRRGGNRNSDWSSDTN

RQGQQS SSSDCYIYDSTTGYYYDPLAGTYYDPNTQ QEVYVPQDPESPDEEEIKEKKSTSQGKSNSKKETSKRDGKEKKDRGMTK FQESTSEGKPPLE

DVFKKPLPPTVKKEESPPP PKVVNPLIGLLGEYGGDSDYEEEEEEEQAPPVQPRTAQPREEMTKKENEDDKLTDWNKLACLLCRRQFPNKEVLTKHQQL

SDLHK - UNI3952 - QNLEIHRKIKQSEQELAYLERRERE - UNI8886 - GRFKEKGNDRREKLQSFDSPERKRIKYSRETDS SDRNPVDKED

TDTSSKGGCAQQATGWRKGAGLGYSHPGLGSSEE - UNI26506 - IEGRMRGPGGGPPGRTSKRQSNETYRDAVRRVMFARYKELD

For any suggestions or comments, please send an email to unitrap@crg.es