Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032590 (Apeh)
Chromosomal location
Chr 9: 107987748 - 107996797 (-)
Description
acylpeptide hydrolase Gene [Source:MGI Symbol;Acc:MGI:88041]
RefSeq_peptide
NP_666338.1 
MGI
MGI:88041 
Uniprot/SWISSPROT
Q8R146 
Human Ortholog
ENSG00000164062 (APEH)
Omim not available
UniTrap UNI26880
Vector Insertion
Chr 9: 107995406 - 107995952
Public Clones not available
Private Clones OST88678 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000081309
Sequence
CTGCTACCGAAAGACCGACTATGGAGCGTCAG GTGCTGCTGAGTGAGCCCCAGGAGGCGGCAGCGCTGTACCGGGGCCTTAGCCGCCAGCCTTCGCTGA

GCGCCGCCTGCCTGGGCCCGGAGGTCACCACGCAGTATGGGGGCCTCTATCGGACTGTGCACACTG AGTGGACTCAGAGGGACTTGGATCGAATGGAGA

ACATCCGATTCTGCCGCCAGTACCTAGTGTTCCATGATGGAGACTCGGTGGTGTTTGCCGGGCCTGCGGGCAACAGTGTGGAAACCCGGGGGGA - UNI

26880 - GCTGCTGAGCAGAGAGTCTCCTTCAGGCACCATGAAAGCAGTGCTGCGCAAGGCTGGAGGTGCAGTCTCGGGAGAGGAAAAACAGTTCTTGG

AG GTCTGGGAGAAGAACCGCAAGCTCAAGAGTTTCAACCTGTCTGCACTGGAGAAGCATGGGCCTGTGTATGAAGATG ACTGCTTTGGCTGCCTCTCC

TGGTCACACTCAGAGACGCACTTGTTGTATGTGGCGGAGAAGAAGCGTCCCAAAGCTGAGTCCTTCTTTCAAACCAAAGCCTTGGACGTCAGTGCCAGTG

ATGAGGAGATGGCCAGGCCGAAGAAGCCAGACCAGGCCATCAAG GGGGACCAGTTTGTATTTTATGAAGACTGGGGAGAAACTATGGTTTCCAAAAGCA

TCCCTGTGCTCTGCGTGCTGGATATCGAGAGTGGTAACATCTCCGTGCTTGAGGGCGTCCCTGAAAATGTGTCCCCTGGTCAG GCTTTCTGGGCCCCTG

GAGACACGGGTGTGGTGTTTGTGGGCTGGTGGCACGAACCCTTCCGGCTAGGTATCCGCTACTGCACCAATCGCAG GTCAGCCCTGTACTATGTGGACC

TGAGCGGGGGGAAGTGTG AACTACTCTCGGATGAGTCCCTGGCTGTCTGCTCTCCTCGGCTGAGCCCAGACCAGTGTCGCGTCGTCTACCTGCAGTACC

CATCTCTAGCCCCTCATCACCAGTGCAGCCAGCTCTTCCTG TATGACTGGTACACCAAGGTCACCTCATTGGTGGTGGACATTGTACCTCGGCAGCTGG

GAG AGAGCTTCTCTGGGATCTACTGCAGCCTCCTTCCTTTGGGATGCTGGTCAGCTGACAGCCAGAGAGTGGTCTTCGACTCGGTCCAGCGCAGTCGGC

AG GACCTGTTTGCTGTGGACACCCAGACAGGAAGTGTCACCTCCCTGACAGCTG GGGGGTCAGCGGGAAGCTGGAAGCTGCTTACAATTGACCGAGAC

CTTATGGTGGCCCAGTTCTCCACACCCAACCTGCCCCCGAGCCTG AAAGTCGGGTTCCTGCCTCCTGCTGGGAAGGAGCAGTCTGTGTCATGGGTGTCA

CTGGAGGAGGCTGAACCTATTCCTGACATCCACTGGGGCATCCGAGTGCTGCACCCACCTCCAGACCAAGAGAATGTACAATATG CTGACCTTGACTTT

GAAGCAATCCTCCTGCAGCCCAGCAACTCTCCAGATAAGAGCCAGGTCCCCATGGTAGTCATGCCCCATG GGGGACCCCACTCTTCCTTTGTCACTGCC

TGGATGCTGTTCCCAGCCATGCTTTGCAAGATGGGCTTTGCAGTACTACTGG TGAACTATCGTGGTTCCACGGGCTTTGGCCAAGACAGCATCCTTTCC

CTCCCAGGCAATGTGGGCCACCAGGATGTGAAGGATGTCCAG TTCGCAGTGCAGCAGGTGCTCCAGGAGGAACACTTTGATGCAAGACGTGTGGCCCTT

ATGGGTGGTTCCCATGGTGGGTTCCTCTCCTGCCACCTGATTGGTCAATACCCAGAAACCTACAGTGCCTGTATAGCCCGGAACCCAGTGATCAACATTG

TCTCCATGATGGGCACCACTGACATCCCTGATTG GTGTATGGTGGAGACTGGCTTCCCTTATAGTAATGACTACCTGCCAGACCTGAATGTGTTGGAAG

AGATGCTGGATAAATCACCCATCAAGTACATCCCTCAG GTAAAGACACCAGTGTTACTGATGCTGGGCCAGGAGGACCGGCGTGTACCCTTCAAGCAGG

GTCTGGAGTATTACCATGCCCTCAAGGCCCGGAATGTGCCTGTCCG GCTCCTGCTGTATCCCAAGAGCACCCATGCGCTGTCAGAGGTGGAGGTGGAAT

CAGACAGCTTCATGAACACTGTGCTTTGGCTACACACACACTTGGGCAGCTGAAGCCCTGTTGCTCTTTGTGAGCTGGGCAGTCCGTCTCGAACTTTGCT

CTTGGTAAGCCCCAGGATCTGGCAGAACTGCCTAGAGGTTTCCTGGGCTCTGGACTCCGAATGAGTGGGCAGAGGACTATGGACTCTAATCATAATAAAG

GAGGACAC
Translation
MERQ VLLSEPQEAAALYRGLSRQPSLSAACLGPEVTTQYGGLYRTVHTE EWTQRDLDRMENIRFCRQYLVFHDGDSVVFAGPAGNSVETRGE - UNI

26880 - ELLSRESPSGTMKAVLRKAGGAVSGEEKQFLE VWEKNRKLKSFNLSALEKHGPVYEDD DCFGCLSWSHSETHLLYVAEKKRPKAESFFQT

KALDVSASDEEMARPKKPDQAIK GDQFVFYEDWGETMVSKSIPVLCVLDIESGNISVLEGVPENVSPGQ AFWAPGDTGVVFVGWWHEPFRLGIRYCTN

RR RSALYYVDLSGGKCE ELLSDESLAVCSPRLSPDQCRVVYLQYPSLAPHHQCSQLFL YDWYTKVTSLVVDIVPRQLGE ESFSGIYCSLLPLGCWS

ADSQRVVFDSVQRSRQ DLFAVDTQTGSVTSLTAG GGSAGSWKLLTIDRDLMVAQFSTPNLPPSL KVGFLPPAGKEQSVSWVSLEEAEPIPDIHWGIR

VLHPPPDQENVQYA ADLDFEAILLQPSNSPDKSQVPMVVMPHG GGPHSSFVTAWMLFPAMLCKMGFAVLLV VNYRGSTGFGQDSILSLPGNVGHQDV

KDVQ FAVQQVLQEEHFDARRVALMGGSHGGFLSCHLIGQYPETYSACIARNPVINIVSMMGTTDIPDW WCMVETGFPYSNDYLPDLNVLEEMLDKSPI

KYIPQ VKTPVLLMLGQEDRRVPFKQGLEYYHALKARNVPVR RLLLYPKSTHALSEVEVESDSFMNTVLWLHTHLGS

For any suggestions or comments, please send an email to unitrap@crg.es