Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032594 (Ihpk1)
Chromosomal location
Chr 9: 107904920 - 107951111 (+)
Description
inositol hexaphosphate kinase 1 Gene [Source:MGI Symbol;Acc:MGI:1351633]
RefSeq_dna
NM_013785 
RefSeq_peptide
NP_038813.2 
UniGene
Mm.276155 Mm.397781 
MGI
MGI:1351633 
Uniprot/SWISSPROT
Q6PD10 
Uniprot/SPTREMBL
Q3UGJ0 Q6A097 
Human Ortholog
ENSG00000176095 (IHPK1)
Omim not available
UniTrap UNI13623
Vector Insertion
Chr 9: 107905154 - 107926433
Public Clones (sanger) D026E10 (ggtc) E059A02 (ggtc) D119A02 (ggtc) CMHD-GT_266E9-3 (cmhd)
PST17484-NL (escells) IST14169D4 (tigm) IST15061E4 (tigm) IST14185C6 (tigm)
IST13606H4 (tigm)
Private Clones OST301633 (lexicon) OST278503 (lexicon) OST247240 (lexicon) OST230456 (lexicon)
OST134847 (lexicon) OST31987 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13636
Vector Insertion
Chr 9: 107926782 - 107934329
Public Clones (sanger) E076G12 (ggtc) CMHD-GT_264A9-3 (cmhd)
Private Clones OST244539 (lexicon) OST243234 (lexicon) OST137568 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20392
Vector Insertion
Chr 9: 107934541 - 107943235
Public Clones E076G12 (ggtc)
Private Clones OST364693 (lexicon) OST41014 (lexicon)
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17716
Vector Insertion
Chr 9: 107943418 - 107947055
Public Clones not available
Private Clones OST437524 (lexicon)
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035214
Sequence
GCTGTCCTTGGTTACTATGACGCCCGGCCCCCGCCCCCTCGGCTGGCCGCCATCTTGTTGTTGATCCGTACCCAGTGGGCAGCGCCAGGAGCTGGACCGA

GCGGCCGGTGAGGGGCCGCTGCTGCGGGGCTCAGCCACCAGCGCCGCCTGCCAGGGGGGCGGGCCGAGACCTGGAGGCCCGGGGGGCCCAGCTCCCGTGG

GGAGCCTTGGGCGCCCGCTGCCCGAGTCGGGCCG - UNI13623 - GACAGAACAGTAAACTAAGCAGACTGTGACCATTGGCCTCCCACTAGCCAGG

ATCAACTTAGCTCTCCTTTTGTGGTCCATGTGCTGCATCGTCTGCCATCAGTGTGCAACCGGCCCCCAACGCAATGTGTGTTTGTCAAACCATGGAAGTG

GGGCAGTATGGCAAGAACGCAAGTCGGGCCGGAGACCGAGGAGTCCTCCTGGAGCCCTTCATCCATCAGGTGGGCGGGCACAGCAGCATGATGCGGTACG

ACGACCACACTGTGTGCAAACCTCTCATCTCCCGGGAACAGCGCTTCTACGAGTCACTCCCTCCCGAAATGAAGGAATTCACCCCAGAGTACAAAG - U

NI13636 - GCGTGGTTTCTGTCTGTTTTGAGGGAGACAGTGATGGTTACATCAACTTGGTAGCCTATCCTTATGTGGAGAGTGAAACTGTAGAGCAAG

ATGACACACCAGAGCGGGAGCAACCTCGGCGCAAACACTCCCGCCGGAGCCTGCATCGGTCTGGCAGTGGTAGTGACCACAAGGAGGAGAAAGCCAGCCT

GTCCTTTGAGACCTCTGAGAG - UNI20392 - CTCCCAGGAGGCAAAGAGTCCAAAGGTGGAACTGCACAGCCACTCAGATGTCCCTTTCCAGATGC

TAGACAGCAATAGCGGTCTGAGCTCCGAGAAGATCAGCTACAACCCCTGGAGCCTGCGCTGCCACAAGCAGCAGCTGAGCCGCATGCGCTCCGAGTCCAA

GGACCGAAAACTCTACA - UNI17716 - AGTTCCTCCTGCTTGAGAACGTGGTACACCACTTCAAGTACCCCTGTGTGCTGGACTTGAAGATGGGTA

CCCGGCAGCATGGCGATGATGCTTCAGCTGAAAAGGCTGCCCGGCAGATGAGGAAGTGTGAGCAGAGCACGTCGGCCACGCTGGGGGTCAGGGTCTGTGG

CATGCAG GTGTACCAGCTGGACACAGGTCATTACCTCTGCAGGAATAAGTACTATGGCCGTGGACTCTCCATCGAGGGCTTCCGCAATGCGCTCTATCA

GTACCTGCACAATGGCTTGGACCTTCGACGTGACCTTTTTGAGCCAATCCTGAGCAAACTGCGGGGCCTCAAAGCCGTACTGGAGCGGCAGGCCTCCTAC

CGCTTCTACTCCAGCTCCCTGCTTGTCATCTATGATGGCAAGGAGTGCCGGTCTGAGCTACGTCTCAAGCACGTGGACATGGGGCTCCCTGAGGTGCCAC

CACCCTGTGGCCCCAGCACCAGTCCTAGCAGCACCAGTCTTGAGGCTGGCCCCTCTTCTCCGCCCAAGGTGGATGTTCGCATGATTGACTTTGCACACAG

CACATTCAAGGGCTTCCGGGATGACCCCACTGTTCACGATGGGCCAGACAGAGGCTATGTGTTTGGCTTGGAGAATCTTATCAGCATCATGGAGCAGATG

CGGGATGAGAACCAGTAGGCCCTGTGCTGGGCCTAGGACCCCCCTCCTCTCCACCCACAGGCAGGGACCATTGCTCTGAACTTGCTGTGAGGACACACAG

ACTTGCTTTTAAAGGGTTATATTTCTCTTTGGTGTAAACTAAAAGAAATGTTTTTAGCTGTAGCCTGGAATCCATATATATAAAGTAGAGGAGGGCAGAA

CATTTGTCCTCTCAGCCAGGCTCCTTAGCTCTGTGGCTGTGACTGCTGTGTCCAGGCTGTCTCAGGAAGGAAGAGGTGGCCCCAGTGGGCTTGACAGCAA

AGAGAATGAATGCCTTGAACTTTGGTCTCCCTTGCCTAAGGCGTTTGGGATCTGTGGCTGTGGGGCTCTGCTGATGGTGAGGTGAAGCCCTCGGCTGGCA

CACGGTCTCCATGCCCAATCATCCCTTATTTCCCAGAACTGGGGAAGGTTAAGTGCCCACGTCCTGAGGGCCATCTTAGTTTCGTGCCAGTGCTGTAACA

GATGCCTCAGGGCATTAGAGGGCTAGCTGCACAGACGGACTCACCCTTGGGTCTGATTTTGGCATGGGGCTAGATCGGTGAAACTGAGCTAAGGCCAACT

CAGCAGAGGGCAGGCCCTGGGCTCCCTAGGCACCCACTGGCATGTAACCCTGTTCCTCTCTCCACAACTCGAGCCAGCCTCTTGCTGGGATCCCTGACCT

AAGGAGGCCTCATAGCCTCCTATCCCACTAAGATGGGCACAGCTGTTTGCTGAGGAGAGCCAGTGTCCCAGGAGGCCTAAGGGCGGGACTTTAGTGGCTC

TGGCCCAGACAGTATTTGCAGTTCTGGGCTCTGGGTGGCATCCCTTCCTCACCTGGGGCAGCTGTGCTGCTTGTGGGTGGGCTGCTGCTCCCAGGGCTCA

GGAACCGTGGTCCGCTCAGGGTCTTGTCTTCTCCAGGCCAAGCTCAAGGCAGCAGCCCTGTATGTGGTGCTCCAGGCTCTAGGCCTGGAGGGAGAACTTT

AAACTTGTTTGCTTTTAGGGACATAGGGCCCTGGGCACAGGTGCCCAGCGTCTGCTGAGAGCTTTGATTAATCCTGGGGTTTGTCAGTAAGTCCATTTGT

CCACCTGCTAGCCCCTGTCTCATGGTGAGCTTTCTGGAGTATAGCCTTGTTGGTTAGTATATATTGATTTCCTTCATGCTTCCCCCAGCAGTCTTCTCCT

TTCCTTTTCTGAGGTGAGTCTGCTCCTGTGCCCCTCCTCAGCAGGTTCTGCTGTTACAAACCTGGTGGCCAAATGATTCATAGTGGTGTTTACCTGCTAG

CCCAGTGGCCTTCTTGTGGGCCTGGGGTATGGCCTTCAGCACCAACGGTGGGTAATGAAGGCTCAGGGTTGACCCTGACCTATTGCTTTTATTTCTGCTA

CCAGTCCTTTCATGGTAGAGACCTGCTGCTGCCTGTAACATAGTGTCCGACAGGTTACACTACACCAATCATTGCCAAGGTGAGCAACAGTCTCCAAGTC

TATCACTTCTAACATGTCTCTGTTTTGGCATTTGAAGGTAATCCTGCCAACCTTTGAGAGAAACTGTTAACGAATGGCATAATTTCCAGGTTCTTAGAGA

TGCAGCCTCTGAAAAGGGTTCTGTGACGGATCCAAGTCAGTCTTCTGACCCTGGTGCCATTGGTGGGCAGGTTCCCATTCCTTAGGGCCGGGAGGCACGG

CTTGGCCCATCTCTGCTTACTAACACCTGTCTTCTGTCCAGTAGTAGTGTTGCTTGTGCCATGCAGGCAGCAAGTGTTAATTAGCGTGGACACCTTTTCT

TTGGCAGGATAGAGGTCAAGAGAGGAGTTTGGGGCCAGCAGAGACCTCCTAGGAATGTGCTGTACTTCCGATTTACCAGATTTTGGGAGGTGCTGCCCCC

ATTCTGCTGCTTCTCAAGTAGCAAGGGAGTTGGTAGGCACTGCTCCTGCCACTGCAAGCGAGGAAAGGCTGGGATTTGCCGCTGCTCAAGGGCAGGGCCT

CACTTTTCAGCACTTTTGATATCTGGAGGCCCAGCTCTGTTATCTGATAGGTGGTGGCAAGTGTGTGCGAACACTTTTACCACTGCTCTTCTGCCTGTCC

CAGGCTAGAGCCCTGTCTTTTTCCTGACAGGTCCTGCCTTCCCAATCATCAATTTGGGACCAAAGTGCAACTAGGGATCATGGGTTGGGAGCTCACATTA

CCCCTTTCCATTGTATTTCCCGGGCCAAGCCCATACCAGCCCGGGGAGATGGGTGGGAGTGAAATGGGATGGGTGCTGCTGGAAGAGGAAGGGACCAGTA

GAGCAATGTCCTTGCCTGGGATTCTACCCCTCTCAGCTGTGGGCCGTGCAGTGGTGTGGGGATTCATTCTCTCCTAGGGGCAAGGGACCTGGGCTCGGAC

AGTATCCGTTCAGTATCCGCTGCTCATTCGCTCACATCTGGCCACGTGCACGTTCCCTAGATGCAAACTGCTTTGAACTTTACAGCTATATAAGTTGGTT

GTGTGTGTGTGCTCATTTTAAAAACTACATTTTAACGAGGAAAAAGGAGAACCTGGGGAAATTTCCTTTGCTTCTGTGGAGGAAATGTAAGACTTGGAAT

TCTGGAAATTGTTATCTGCTCCTCTTTCCTGGAAGCTACACACCCTAAGACCTGCGCCTGGATGCATACGTGGCTCCACTGGCGCTTAGGCGCGCTTGCA

TTTTCCCCAGGTCTTCTGTGTGGTGGAGAGGAGTGCTTGGCCCAAGCCGGCCCTTTTCTGTACACCCAGCGCTATCCGCCCGCTTGTGTCTGGTCGTATA

CGTCAAAATAAAGCCTCTAGAAACTG
Translation
 - UNI13623 - MCVCQTMEVGQYGKNASRAGDRGVLLEPFIHQVGGHSSMMRYDDHTVCKPLISREQRFYESLPPEMKEFTPEYKG - UNI13636

 - GVVSVCFEGDSDGYINLVAYPYVESETVEQDDTPEREQPRRKHSRRSLHRSGSGSDHKEEKASLSFETSES - UNI20392 - SSQEAKSPKVEL

HSHSDVPFQMLDSNSGLSSEKISYNPWSLRCHKQQLSRMRSESKDRKLYK - UNI17716 - KFLLLENVVHHFKYPCVLDLKMGTRQHGDDASAEKA

ARQMRKCEQSTSATLGVRVCGMQ VYQLDTGHYLCRNKYYGRGLSIEGFRNALYQYLHNGLDLRRDLFEPILSKLRGLKAVLERQASYRFYSSSLLVIYD

GKECRSELRLKHVDMGLPEVPPPCGPSTSPSSTSLEAGPSSPPKVDVRMIDFAHSTFKGFRDDPTVHDGPDRGYVFGLENLISIMEQMRDENQ

For any suggestions or comments, please send an email to unitrap@crg.es