Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032602 (Slc25a20)
Chromosomal location
Chr 9: 108564487 - 108586468 (+)
Description
solute carrier family 25 (mitochondrial carnitine/acylcarnitine translocase), member 20 Gene [Source:MGI Symbol;Acc:MGI:1928738]
RefSeq_dna
NM_020520 
RefSeq_peptide
NP_065266.1 
MGI
MGI:1928738 
Uniprot/SWISSPROT
Q9Z2Z6 
Uniprot/SPTREMBL
Q7TPW6 
Human Ortholog
ENSG00000178537 (SLC25A20)
Omim 212138 - SOLUTE CARRIER FAMILY 25 (CARNITINE/ACYLCARNITINE TRANSLOCASE), MEMBER  
UniTrap UNI7651
Vector Insertion
Chr 9: 108564664 - 108572096
Public Clones RRR730 (baygenomics) IST15083G2 (tigm) IST12419A4 (tigm) IST11558A8 (tigm)
Private Clones OST282402 (lexicon) OST261797 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25359
Vector Insertion
Chr 9: 108572190 - 108574749
Public Clones not available
Private Clones OST186735 (lexicon) OST184663 (lexicon)
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24713
Vector Insertion
Chr 9: 108574878 - 108579914
Public Clones not available
Private Clones OST209204 (lexicon)
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29291
Vector Insertion
Chr 9: 108582536 - 108584302
Public Clones not available
Private Clones OST445 (lexicon)
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035222
Sequence
CGGAGCCGCTCGGGCAGCGGAGCAAGACCAAGACTGCCCGGAGCTGACAGACAGACAGACAGAAGACTGAGCATGGCAGACGAGCCGAAACCCATCAGTC

CGTTTAAGAACCTCCTGGCTGGCGGCTTCGGCGGCATGTGCCTGGTGTTTGTGGGGCACCCCCTGGACACGGTCAAG - UNI7651 - GTCCGACTGC

AGACACAACCACCAAGTTTGTCTGGACAGCCACCTATGTACTCTGGGACCTTGGACTGTTTCCGGAAGACTCTTATGAGAGAG - UNI25359 - GGC

ATCACAGGGCTGTATCGGGGCATGGCTGCGCCCATCATTGGAGTCACCCCTATGTTCGCCGTGTGCTTCTTTGGGTTTGGTCTGGGGAAGAAACTACAGC

AGAAATCTCCAGAGGATGAACTTAG - UNI24713 - CTACCCACAGCTGTTTACAGCTGGGATGTTATCTGGTGTGTTCACCACAGGAATCATGACC

CCTGGAGAACGGATCAAATGCTTACTGCAG ATTCAGGCTTCTTCAGGGGAGAACAAGTACAGTGGCACCTTGGACTGCGCAAAGAAGCTGTATCAGGAG

TTCGGGATCCGCGGCTTCTACAAAGGGACTGTGCTCACACTCATGCGAG - UNI29291 - ATGTTCCTGCCAGTGGGATGTATTTCATGACATATGA

ATGGCTTAAAAATCTCTTCACTCCAGAGGGAAAGAG TGTCAGTGACCTCAGCGTGCCTCGGATCCTGGTGGCTGGTGGCTTTGCAGGGATCTTCAACTG

GGCCGTGGCAATCCCCCCGGACGTGCTCAAGTCTCGATTCCAGACTG CACCTCCTGGAAAATATCCTAATGGTTTCAGAGATGTGTTGAGAGAGCTGAT

CCGAGAAGAAGGAGTCACCTCCTTGTACAAAGGGTTCAATGCAGTCATGATCCGCGCCTTCCCAGCCAACGCT GCCTGTTTCCTTGGCTTTGAAATTGC

CATGAAGTTCCTTAATTGGATTGCCCCCAACTTGTGAAGCTGAAGACTCTTCAAGACCTGTGGATGCTGGACACTGTTGCTGAGAGGCAGGGGCAGGAGG

AGGAAGTCCTGAGAGGGAGGGGAGGGAAGAGGTGTGATCAGAGCTCCAGGCTTGGCTGTGATGGTGAAACTGTTGCCTTAATGATATCCTCTACCTTGTA

TAACTTGGTGCCATTTTGAAACTTGAATTTAGAGGATTTCCAGAGAATTGGAGATGGAATAAATAGTTTATAGACTCGAT
Translation
MADEPKPISPFKNLLAGGFGGMCLVFVGHPLDTVK - UNI7651 - VRLQTQPPSLSGQPPMYSGTLDCFRKTLMRE - UNI25359 - GITGLYR

GMAAPIIGVTPMFAVCFFGFGLGKKLQQKSPEDELS - UNI24713 - SYPQLFTAGMLSGVFTTGIMTPGERIKCLLQ IQASSGENKYSGTLDCAK

KLYQEFGIRGFYKGTVLTLMRD - UNI29291 - DVPASGMYFMTYEWLKNLFTPEGKS SVSDLSVPRILVAGGFAGIFNWAVAIPPDVLKSRFQTA

 APPGKYPNGFRDVLRELIREEGVTSLYKGFNAVMIRAFPANA ACFLGFEIAMKFLNWIAPNL

For any suggestions or comments, please send an email to unitrap@crg.es