Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032612 (Usp4)
Chromosomal location
Chr 9: 108250199 - 108294857 (+)
Description
ubiquitin specific peptidase 4 (proto-oncogene) Gene [Source:MGI Symbol;Acc:MGI:98905]
RefSeq_dna
NM_011678 
RefSeq_peptide
NP_035808.2 
UniGene
Mm.3974 
MGI
MGI:98905 
Uniprot/SWISSPROT
P35123 
Uniprot/SPTREMBL
Q3TEX8 Q3TPN5 Q3TQZ9 Q5DTK8 Q6NXV6 Q8BTL9 Q921M8 
Human Ortholog
ENSG00000114316 (USP4)
Omim not available
UniTrap UNI26420
Vector Insertion
Chr 9: 108262553 - 108264891
Public Clones not available
Private Clones OST119124 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30436
Vector Insertion
Chr 9: 108287288 - 108290607
Public Clones CMHD-GT_364H12-3 (cmhd) (cmhd) CMHD-GT_364G12-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28381
Vector Insertion
Chr 9: 108290712 - 108293310
Public Clones not available
Private Clones OST32468 (lexicon) OST29603 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035237
Sequence
CCGTGCGCTAGGCGGATGTCCGGGCCGGCTGGGCCGGGGCGGCGGACGAGATGGCGGAAGGCCGGGGCAGCCGTGAGCGACCGGATGTGGAGACCCAGAA

GACGGAGCTCGGAGCCTTGATGGGGACCACGCTCCAACGTGGGGCGCAGTG GTATCTTATTGACAGCCGGTGGTTCAAGCAGTGGAAGAAGTATGTGGG

CTTTGACAGCTGGGACATGTACAATGTCGGGGAGCATAACCTGTTTCCTGGACCTATTGACAACTCCGGACTCTTCTCAG ATCCTGAGAGTCAGACCTT

GAAGGAGCACTTAATCGATGAGCTGGACTATGTGCTGGTCCCAGCCGAAGCCTGGAATAAATTGCTGAATTGGTATGGCTGTGTGGAGGGCCAGCAGCCT

ATTGTCAGAAAA GTTGTGGAGCATGGCCTGTTTGTCAAGCACTGCAAAGTGGAAGTGTATTTGCTGGAGCTGAAGCTCTGTGAGAACAGTGACCCCACC

AATGTGCTAAGTTGCCATTTTAGCAAAGCAGACACCATTG - UNI26420 - CAACTATTGAGAAGGAGATGAGGAAGCTCTTCAACATCCCTGCAGA

ACGTGAAACACGGCTTTGGAACAAATACATGAGCAACACCTATGAGCAGTTGAGCAAGCTAGACAACACTATCCAGGATGCTGGGCTGTACCAGGGTCAG

 GTGCTAGTAATTGAGCCCCAAAATGAAGATGGCACATGGCCCCGGCAGAGCCTGCAGTCAAA ATCAAGCACTGCACCTAGCAGAAATTTCACTACCTC

TTCAAAACCATCCGCAAGTCCCTATTGCTCAGTGTCTGCCTCTCTCATTGCAAATGGTGATAGCACTAACAGCTCTGGGATGCACAGCTCCGGTGTCAGC

AGGGG TGGATCTGGCTTCTCTGCTTCGTATAATTGCCAGGAGCCCCCATCACCTCATATACAGCCTGGCCTCTGTGGACTTGGAAACCTGGGGAACACT

TGCTTCATGAACTCTGCTCTGCAG TGCCTGAGCAACACTGCCCCACTGACTGAGTACTTTCTCAAAGATGAGTATGAGGCCGAGATCAACCGAGACAAC

CCTCTGGGGATGAAAGGGGAGATTGCAGAGGCCTATGCAGAGCTCATCAAGCAGATGTGGTCTGGAAGGGACACTCACGTGGCACCACGGATGTTCAAG 

ACGCAAGTGGGACGTTTTGCCCCTCAGTTTTCTGGCTACCAACAGCAAGACTCCCAGGAGCTGCTAGCCTTTATTCTAGACGGACTGCACGAGGACCTGA

ACCGCGTAAAGAAGAAGCCTTACCTGGAGCCCAAGGACGCCAATGGGCGACCAGATGCG GTGGTAGCAAAGGAAGCCTGGGAAAACCACAGGCTGAGGA

ATGATTCTGTGATTGTGGATACTTTCCATGGCCTTTTCAAATCGACTTTGGTTTGCCCAGAATGTGCTAAAGTTTCTGTGACCTTTGACCCATTTTGCTA

TCTAACTCTCCCACTGCCTTTGAAGAAGGATCGGATTATGGAGGTCTTCCTGGTTCCTGCTGACCCTCAGTGCAGACCTATCCAG TACCGTGTGACTGT

GCCATTGATGGGGGCCATTTCTGACCTGTGTGAAGCACTCTCCAAGCTGTCTGGCATTGCTGCAGAAAAT ATGGTGGTCACTGATGTATATAATCACCG

CTTCCACAAAATTTTCCAAATGGATGAAGGTTTAAGCCACATCACGCCTCGAGATGACATTTTTGT GTATGAGGTCTGCAACACGTCCATGGATGGCTC

AGAGTGTATCACTCTTCCAGTCTACTTCAGAGAGAAGAAGTCCAGGCCGTCGAGTGCTTCCTCGGGGGCTGTGCTCTATGGACAGCCCCTTCTTGTCTCT

GTCCCTAAGCATAAGCTAACCCTAGAGTCTTTGTACCAGGCTGTTTGTGATCGTATCAG CCGCTACATAAAACAGCCTTTGCCTGATGAGTTTCTCAGC

TCACCCTTAGAGCCTGGGGCCTGCAATGGCTCTAGGAGTAGCTATGAAG GAGATGAAGAGGAAGAAATGGATCATCAAGAGGAAGGAAAAGAGCAGCTT

TCCGAAGTGGAAGGCAGTGGTGAGGACGATCAGGGAGATGACCATAGCGAGAGCGCCCAAAAGGTGAAAGGCCAGCCGAGGCACAAGAGGCTCTTTACCT

TCAGCCTCGTGAACTCCTGTGGAACTGCTGATATCAATTCACTGGCAACTGACGGGAAACTCCTCAAACTCAACT CTCGATCCACACTGGCCATTGACT

GGGACAGTGAGACCCGAAGCCTTTACTTTGATGAGCAAGAATCTGAG GCCTGTGAGAAGCACCTGAGCATGTCACAGCCGCAGAAGAAGAAGAAGGCGG

CAGTAGCCCTGCGAGAGTGCATCGAGCTCTTCACCACCATGGAGACCCTTGGGGAGCATGACCCCTG GTACTGTCCCACCTGTAAGAAGCACCAGCAGG

CAACAAAGAAGTTTGACTTGTGGTCTTTGCCCAAGATCCTGGTGGTTCACCTCAAGCGTTTCTCCTATAACAGATACTGGCGGGATAAACTTGACACCGT

GGTGGAGTTCCCAGTCAG - UNI30436 - AGCTCTGAACATGTCCGAGTTTGTCTGTGACCGGTCAGCAAGGCCTTATGTTTATGACCTAATTGCTG

TGTCCAATCACTATGGAGCCATGGGGGTTGGTCACT - UNI28381 - ACACTGCATATGCGAAGAACAGACTGAACGGGAAATGGTATTACTTTGAT

GATAGCAGTGTGTCCCTGGCCTCTGAGGACCAGATAGTG ACGAAAGCCGCCTACGTGTTGTTCTATCAGCGTCGGGATGACGAATGCTCCAGCACATCT

TCGCTCGGCAGTTTCCCCGGTTCTGATGGAGGGGTGAAGCTGAGCAGCTCACACCAGGGCATGGGGGATGAGGAGGCTTACAACATGGACACCAACTGAT

GTGGCCTCTGTGACCCTGCCACCCTCCCAACACCAGCATCCTCCCCCAGGAGAATATCTGTGGCACTCTTGAAGACTGCTCATATCAATCTCAAACCAGA

TGAGGACATTACCTCCTTTTATGAGAAGAGGAAGGAAAGAGAAACCCTGCTTTCTGAGAAGGGCTCTATGTTAAGAGGCTGGATTATTTTTTCTTTTAAA

CGGGTGGTGAGAGAAAAACCTGTGGAGCTCAATTGTGGGCTGGGGTTTGGTGCACAGTGGCATGTGTCTCATGGATTCCAAAGAGTGGAGAGGAAGACCC

TGCAATGAGCATGGTGCAGCCATGAAGACCCACCTGCAGGGCTGCTCCGAACTGGGTTTTGGATTCTGGTGCCCACACTGCTCACCCCAGTAGTCTGGCC

ACAGTAAACCAAGCCTCCAGCAAATTTGATGTTGTCCTCTAGTTCTTTGCTGTTCATTGAGATGGGCTTATAGTTTTCTAAACTGTCTCTGAAACCCGTT

TCTATTCTCTTGTTCTCTCAGAATTTTCCAGCCGCCTTCCCGGTTATGAAATGAAGTTAGTATTGGGCTATTGTTTTCAGTTTCTCACAGACTCCTAGAA

GTTCTGTTTTGTCCCCCACTGCCCTTGATAAAGTGATTCTATGTGGAACTTTCATTAGCTCTCCCTTAAAAGAAGTCTATTCATAAAA
Translation
MAEGRGSRERPDVETQKTELGALMGTTLQRGAQW WYLIDSRWFKQWKKYVGFDSWDMYNVGEHNLFPGPIDNSGLFSD DPESQTLKEHLIDELDYVLV

PAEAWNKLLNWYGCVEGQQPIVRK VVEHGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIA - UNI26420 - ATIEKEMRKLFNIPAERE

TRLWNKYMSNTYEQLSKLDNTIQDAGLYQGQ VLVIEPQNEDGTWPRQSLQSK KSSTAPSRNFTTSSKPSASPYCSVSASLIANGDSTNSSGMHSSGVS

RG GGSGFSASYNCQEPPSPHIQPGLCGLGNLGNTCFMNSALQ CLSNTAPLTEYFLKDEYEAEINRDNPLGMKGEIAEAYAELIKQMWSGRDTHVAPRM

FK TQVGRFAPQFSGYQQQDSQELLAFILDGLHEDLNRVKKKPYLEPKDANGRPDA VVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFD

PFCYLTLPLPLKKDRIMEVFLVPADPQCRPIQ YRVTVPLMGAISDLCEALSKLSGIAAEN MVVTDVYNHRFHKIFQMDEGLSHITPRDDIFV VYEVC

NTSMDGSECITLPVYFREKKSRPSSASSGAVLYGQPLLVSVPKHKLTLESLYQAVCDRIS SRYIKQPLPDEFLSSPLEPGACNGSRSSYEG GDEEEEM

DHQEEGKEQLSEVEGSGEDDQGDDHSESAQKVKGQPRHKRLFTFSLVNSCGTADINSLATDGKLLKLNS SRSTLAIDWDSETRSLYFDEQESE ACEKH

LSMSQPQKKKKAAVALRECIELFTTMETLGEHDPW WYCPTCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDTVVEFPVR - UNI30436 -

 RALNMSEFVCDRSARPYVYDLIAVSNHYGAMGVGHY - UNI28381 - YTAYAKNRLNGKWYYFDDSSVSLASEDQIV TKAAYVLFYQRRDDECSS

TSSLGSFPGSDGGVKLSSSHQGMGDEEAYNMDTN
Transcript ENSMUST00000076375
Sequence
CCGTGCGCTAGGCGGATGTCCGGGCCGGCTGGGCCGGGGCGGCGGACGAGATGGCGGAAGGCCGGGGCAGCCGTGAGCGACCGGATGTGGAGACCCAGAA

GACGGAGCTCGGAGCCTTGATGGGGACCACGCTCCAACGTGGGGCGCAGTG GTATCTTATTGACAGCCGGTGGTTCAAGCAGTGGAAGAAGTATGTGGG

CTTTGACAGCTGGGACATGTACAATGTCGGGGAGCATAACCTGTTTCCTGGACCTATTGACAACTCCGGACTCTTCTCAG ATCCTGAGAGTCAGACCTT

GAAGGAGCACTTAATCGATGAGCTGGACTATGTGCTGGTCCCAGCCGAAGCCTGGAATAAATTGCTGAATTGGTATGGCTGTGTGGAGGGCCAGCAGCCT

ATTGTCAGAAAA GTTGTGGAGCATGGCCTGTTTGTCAAGCACTGCAAAGTGGAAGTGTATTTGCTGGAGCTGAAGCTCTGTGAGAACAGTGACCCCACC

AATGTGCTAAGTTGCCATTTTAGCAAAGCAGACACCATTG - UNI26420 - CAACTATTGAGAAGGAGATGAGGAAGCTCTTCAACATCCCTGCAGA

ACGTGAAACACGGCTTTGGAACAAATACATGAGCAACACCTATGAGCAGTTGAGCAAGCTAGACAACACTATCCAGGATGCTGGGCTGTACCAGGGTCAG

 GTGCTAGTAATTGAGCCCCAAAATGAAGATGGCACATGGCCCCGGCAGAGCCTGCAGTCAAA TGGATCTGGCTTCTCTGCTTCGTATAATTGCCAGGA

GCCCCCATCACCTCATATACAGCCTGGCCTCTGTGGACTTGGAAACCTGGGGAACACTTGCTTCATGAACTCTGCTCTGCAG TGCCTGAGCAACACTGC

CCCACTGACTGAGTACTTTCTCAAAGATGAGTATGAGGCCGAGATCAACCGAGACAACCCTCTGGGGATGAAAGGGGAGATTGCAGAGGCCTATGCAGAG

CTCATCAAGCAGATGTGGTCTGGAAGGGACACTCACGTGGCACCACGGATGTTCAAG ACGCAAGTGGGACGTTTTGCCCCTCAGTTTTCTGGCTACCAA

CAGCAAGACTCCCAGGAGCTGCTAGCCTTTATTCTAGACGGACTGCACGAGGACCTGAACCGCGTAAAGAAGAAGCCTTACCTGGAGCCCAAGGACGCCA

ATGGGCGACCAGATGCG GTGGTAGCAAAGGAAGCCTGGGAAAACCACAGGCTGAGGAATGATTCTGTGATTGTGGATACTTTCCATGGCCTTTTCAAAT

CGACTTTGGTTTGCCCAGAATGTGCTAAAGTTTCTGTGACCTTTGACCCATTTTGCTATCTAACTCTCCCACTGCCTTTGAAGAAGGATCGGATTATGGA

GGTCTTCCTGGTTCCTGCTGACCCTCAGTGCAGACCTATCCAG TACCGTGTGACTGTGCCATTGATGGGGGCCATTTCTGACCTGTGTGAAGCACTCTC

CAAGCTGTCTGGCATTGCTGCAGAAAAT ATGGTGGTCACTGATGTATATAATCACCGCTTCCACAAAATTTTCCAAATGGATGAAGGTTTAAGCCACAT

CACGCCTCGAGATGACATTTTTGT GTATGAGGTCTGCAACACGTCCATGGATGGCTCAGAGTGTATCACTCTTCCAGTCTACTTCAGAGAGAAGAAGTC

CAGGCCGTCGAGTGCTTCCTCGGGGGCTGTGCTCTATGGACAGCCCCTTCTTGTCTCTGTCCCTAAGCATAAGCTAACCCTAGAGTCTTTGTACCAGGCT

GTTTGTGATCGTATCAG CCGCTACATAAAACAGCCTTTGCCTGATGAGTTTCTCAGCTCACCCTTAGAGCCTGGGGCCTGCAATGGCTCTAGGAGTAGC

TATGAAG GAGATGAAGAGGAAGAAATGGATCATCAAGAGGAAGGAAAAGAGCAGCTTTCCGAAGTGGAAGGCAGTGGTGAGGACGATCAGGGAGATGAC

CATAGCGAGAGCGCCCAAAAGGTGAAAGGCCAGCCGAGGCACAAGAGGCTCTTTACCTTCAGCCTCGTGAACTCCTGTGGAACTGCTGATATCAATTCAC

TGGCAACTGACGGGAAACTCCTCAAACTCAACT CTCGATCCACACTGGCCATTGACTGGGACAGTGAGACCCGAAGCCTTTACTTTGATGAGCAAGAAT

CTGAG GCCTGTGAGAAGCACCTGAGCATGTCACAGCCGCAGAAGAAGAAGAAGGCGGCAGTAGCCCTGCGAGAGTGCATCGAGCTCTTCACCACCATGG

AGACCCTTGGGGAGCATGACCCCTG GTACTGTCCCACCTGTAAGAAGCACCAGCAGGCAACAAAGAAGTTTGACTTGTGGTCTTTGCCCAAGATCCTGG

TGGTTCACCTCAAGCGTTTCTCCTATAACAGATACTGGCGGGATAAACTTGACACCGTGGTGGAGTTCCCAGTCAG - UNI30436 - AGCTCTGAAC

ATGTCCGAGTTTGTCTGTGACCGGTCAGCAAGGCCTTATGTTTATGACCTAATTGCTGTGTCCAATCACTATGGAGCCATGGGGGTTGGTCACT - UNI

28381 - ACACTGCATATGCGAAGAACAGACTGAACGGGAAATGGTATTACTTTGATGATAGCAGTGTGTCCCTGGCCTCTGAGGACCAGATAGTG AC

GAAAGCCGCCTACGTGTTGTTCTATCAGCGTCGGGATGACGAATGCTCCAGCACATCTTCGCTCGGCAGTTTCCCCGGTTCTGATGGAGGGGTGAAGCTG

AGCAGCTCACACCAGGGCATGGGGGATGAGGAGGCTTACAACATGGACACCAACTGATGTGGCCTCTGTGACCCTGCCACCCTCCCAACACCAGCATCCT

CCCCCAGGAGAATATCTGTGGCACTCTTGAAGACTGCTCATATCAATCTCAAACCAGATGAGGACATTACCTCCTTTTATGAGAAGAGGAAGGAAAGAGA

AACCCTGCTTTCTGAGAAGGGCTCTATGTTAAGAGGCTGGATTATTTTTTCTTTTAAACGGGTGGTGAGAGAAAAACCTGTGGAGCTCAATTGTGGGCTG

GGGTTTGGTGCACAGTGGCATGTGTCTCATGGATTCCAAAGAGTGGAGAGGAAGACCCTGCAATGAGCATGGTGCAGCCATGAAGACCCACCTGCAGGGC

TGCTCCGAACTGGGTTTTGGATTCTGGTGCCCACACTGCTCACCCCAGTAGTCTGGCCACAGTAAACCAAGCCTCCAGCAAATTTGATGTTGTCCTCTAG

TTCTTTGCTGTTCATTGAGATGGGCTTATAGTTTTCTAAACTGTCTCTGAAACCCGTTTCTATTCTCTTGTTCTCTCAGAATTTTCCAGCCGCCTTCCCG

GTTATGAAATGAAGTTAGTATTGGGCTATTGTTTTCAGTTTCTCACAGACTCCTAGAAGTTCTGTTTTGTCCCCCACTGCCCTTGATAAAGTGATTCTAT

GTGGAACTTTCATTAGCTCTCCCTTAAAAGAAGTCTATTCATAAAA
Translation
MAEGRGSRERPDVETQKTELGALMGTTLQRGAQW WYLIDSRWFKQWKKYVGFDSWDMYNVGEHNLFPGPIDNSGLFSD DPESQTLKEHLIDELDYVLV

PAEAWNKLLNWYGCVEGQQPIVRK VVEHGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIA - UNI26420 - ATIEKEMRKLFNIPAERE

TRLWNKYMSNTYEQLSKLDNTIQDAGLYQGQ VLVIEPQNEDGTWPRQSLQSN NGSGFSASYNCQEPPSPHIQPGLCGLGNLGNTCFMNSALQ CLSNT

APLTEYFLKDEYEAEINRDNPLGMKGEIAEAYAELIKQMWSGRDTHVAPRMFK TQVGRFAPQFSGYQQQDSQELLAFILDGLHEDLNRVKKKPYLEPKD

ANGRPDA VVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLKKDRIMEVFLVPADPQCRPIQ YRVTVPLMGAISDLCE

ALSKLSGIAAEN MVVTDVYNHRFHKIFQMDEGLSHITPRDDIFV VYEVCNTSMDGSECITLPVYFREKKSRPSSASSGAVLYGQPLLVSVPKHKLTLE

SLYQAVCDRIS SRYIKQPLPDEFLSSPLEPGACNGSRSSYEG GDEEEEMDHQEEGKEQLSEVEGSGEDDQGDDHSESAQKVKGQPRHKRLFTFSLVNS

CGTADINSLATDGKLLKLNS SRSTLAIDWDSETRSLYFDEQESE ACEKHLSMSQPQKKKKAAVALRECIELFTTMETLGEHDPW WYCPTCKKHQQAT

KKFDLWSLPKILVVHLKRFSYNRYWRDKLDTVVEFPVR - UNI30436 - RALNMSEFVCDRSARPYVYDLIAVSNHYGAMGVGHY - UNI28381 

- YTAYAKNRLNGKWYYFDDSSVSLASEDQIV TKAAYVLFYQRRDDECSSTSSLGSFPGSDGGVKLSSSHQGMGDEEAYNMDTN

For any suggestions or comments, please send an email to unitrap@crg.es