Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032649 (Glt25d2)
Chromosomal location
Chr 1: 154247051 - 154357824 (+)
Description
glycosyltransferase 25 domain containing 2 Gene [Source:MGI (curated);Acc:Glt25d2-001]
Human Ortholog
not available
Omim not available
UniTrap UNI38570
Vector Insertion
Chr 1: 154247528 - 154315578
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000044311
Sequence
GGAAGATCAGCCTCCCGGAGTCGACCTGTCTGCAGGGCGGAGCGCGGGGCAAGCGCGGGTGGCAGGGAGTCGGTGCACAGGGGACTCAGGTCAAGGCTGG

TCGGCGGCGGGTCCTGCGAGCCTCAGAAATCAGTGCCGGTGCACGCTCCCGCCGTCCCGGGGCAGCCGCATCCCCGGCGCCGCTGGCAGCATCGCCGCCT

CCCGCCGGCTACGGAACATGGCTGCGCGCCTCGCCACTGTCGCCTGCGCGCTGTTCCTGCTGTCCTCCGCCCTGCTCCGCCTCGGCTGCCGGGCGCGCTT

CGCCGCCGAGCCCGACTCGGATGAGGACGGAGAGGAAACGGTGGCGTTCCCCGAGTCGCCCCCGCAGAAACCCACGGTGTTCGTGGTCGTTCTCGCCCGC

AACGCTGCGCATACGCTGCCTTACTTCCTCGGCTGCCTGGAACGGCTGGACTACCCCAAGAGCAGGATGGCTATCTG - UNI38570 - GGCAGCCAC

TGATCACAATGTGGACAATACAACGGAAATACTCAGGGAGTGGCTGAAAAGTGTGCAGCGTTTGTATCACTATGTGGAGTGGAGGCCTATGAACGAGCCA

GA GTCTTACCCTGATGAAATCGGACCAAAGCACTGGCCAAACTCCCGGTTTTCTCACGTCATGAAACTGCGACAAGCAGCCCTTCGAACTGCGAGGGAA

AAATGGTCAGATTACATCCTG TTCATAGATGTCGACAACTTCCTGACTAATCCACAGACCCTGAACCTAATGATTGTAGAAAACAAGACCATCGTGGCG

CCCATGCTGGAGTCCCGGGGTCTATACTCTAACTTCTGGTGCGGAATTACGCCTCAG GGCTTCTACAAGCGGACCCCAGACTACCTTCAGATTAGAGAA

TGGAAAAGGATGGGCTGCTTCCCCGTCCCCATGGTCCACTCCACCTTCCTGATTGACCTCAGGAAAGAGGCCTCTGACAAGCTGGCTTTCTACCCCCCAC

ACCAGGACTACACCTGGACCTTTGATGACATCATCGTTTTTGCCTTCTCCAGCAGGCAAGCAG GCATCCAGATGTACCTGTGCAACAAGGAACACTATG

GCTACCTGCCCATCCCTCTGAAGCCCCACCAGACACTGCAGGAGGACGTCGAGAACCTCATCCATGTACAGATAGAAGCAATGA TTGACCATCCTCCAA

TGGAGCCTTCCCAGTTCGTGTCAGTTGTCCCTAAGTATCCAGACAAGATGGGATTTGATGAG ATTTTCATGATCAACCTCAAACGCAGGAAGGACAGGC

GGGACAGGATGCTGCGCACACTCTACGAACAGGAGATCGAGGTCAAGATTGTCGAGGCCGTGGATGGGAA GGCACTCAACACAAGCCAGCTGAAGGCCT

GGAACATTGAGATGCTGCCAGGGTACCGGGACCCCTACTCCTCCAGGCCTTTAACCAGGGGTGAAATTGGTTGCTTCCTTAGTCACTTCTCTGTCTGGAA

AGAG GTTATTGACCGAGAGCTGGAGAAGACTCTGGTCATCGAGGATGATGTGCGCTTTGAGCATCAGTTTAAGAGGAAGCTGATGAAGCTGATGGAGGA

CATTGACAAGGCTCAGCTGGACTGGGAACTAAT TTACATCGGTCGAAAAAGAATGCAAGTCAAAGAGCCAGAGAAGGCAGTGCCCAATGTTGTAAATCT

CGTCGAAGCTGATTATTCCTACTGGACCCTGGGCTACGCCATTTCCCTGGAAGGAGCACAGAAGCTTGTCGGAGCCGATCCCTTTGGGAAGATGTTGCCA

GTGGATGAGTTTCTGCCAATCATGTACAACAAGCATCCTGT GGCTGAGTACAAGGAGTATTATGAGTCCAGGGACTTGAAAGCCTTCTCCGCAGAGCCT

CTGCTCATCTACCCTACGCACTACACAGGCCAGCCAGGCTATCTGAGCGACACAGAAACGTCAACCATCTGGGACAATGAGACAGTGGCCACTGACTGGG

ACAGGACACACTCCTGGAAATCCCGGAAGCAAGGACACATCCGCAGCACCGCCAAGAACACGGAAGCACTTCCACCGCCAACTTCCCTGGACACTGTGCC

TTCAAGAGACGAACTCTGAAAGCTTCCTGGGTGTGTGGTCTGCAAGGTTCATCACTGTCTGGATTTTCTAAAGGGCTACTCATCTGTTTGCTCCAGTTTG

GGGTTTTGTTTTGTAGAGATGGCAGTCATCTAATCAAGTGGTTTGATGTGACTCATCAAAATTATATCATTTGTATAGTGAAGAACAGAGAAATTAAAAA

CCAAATTCCCTAGGAAGCCATTACTGGAATATCTAGGTTAAACTTCAGTCCAAATGCCCAGTTCTGCTCACTAGCTAGAGAATGCGGTTAGCCACACTGG

TGTGGCAACATGGCTCATATTCTCATCCAAGAAATGGCACCCCAAGCTGTCACATCAGTAAGTGAGCAGTCAACACAGACAAGCCAGTGGACCTTGTTTA

CTAATCTAAGTGGTCCATTTTATGTGGCAGATGTGACCCTGAAATCATCAAGCCATCTAGACTACATTTATTCATCTAATTGATGTGACCTTGAAAACTG

TACTATGTAACAAGTGTCTGGGAATGGGGAAACCAAACCATTAATTGGGCTTTTATTCAAAGGAGCTCTGTCATGAGTTTGTTGCAAAGTGGATGTTTTC

TTCTTGGCTTTATTATCCCATGGAGTGAGAGCTGGAGCGATGGCTCAGTGGTTATTATCCAATGGAGTACGTAACTGGCTTGGGTAGCGACATGGGCTCT

TGACCATCATGGCAGCTAGAGTGTTCATCAAAATGTCTAGGTGCCATGTGGCTATAATATTTAGATATTTATGGGGGAAAGATCTAAACCCTTGGCATTT

GTATTGTGGCTTAAGTCCAATATGTCTATTTATAAAAAACTGTAATATATACAGGTTGTGAGGGATGGGGTGACCCAGAACCTCACACCTTATATGTCAC

CCCTTCGCCTGGGGAGGAACTGCAGGTGTGAGTGTAATAAGTCACTGTTGATGAGTTTAATAAGTCACTGTTGAGGGTCAGAATACATTTCAGCCTCACA

CTTGTCCTCGTTTTGGATTTTCATTATATTCTGAATTATTTATTTTACCAAAGTGGAAAAACCATCGTCTGTAGGGTGAAGCAAGCAGAGGAACAGATGT

CTCAGACTCTCACTGCACACTGGGCAATGTCAGTATTGACACGTGAGTCTGCGCATCTGAATTGCCTGAATTTCCCAGCTTGGCTTTTGCAGGGAAGACC

GCTGGTGAGAAGCTAACCAGTTAGGAGTAACTTATTCTCCAGTGGATATATAAGACACTGGCCTAGACAATAGATTTAAGTCAACGATCCACAGCTCTCA

GAGCCAAAAATCCTAATTAGACACCTTTCTCCAAAAAAGTCCCCTAAAACTTTTTCCTAATTCTTCATAGGTAATTTAATGTCAGGTGCAATGCTGGACT

GTGTCACACACAGTGTCAGGATTCCCAGCCAGCTGTTGAGAGTGCTTGTGGTGCTTCACCTCAGCCACCCTTCCTTCCTGGGTATGATTCAGGCTTCTTG

ACTGAAGCTGAGAAACCAGGCTTATCCAGCCCCAGCTTGTGTCTTCTCATCTAGAGAAAAAGAGAAGAGCATTAAGGAGCTCATGAGGAACCCTAAGTGG

TTCCTAAGGTCTCCTTGGGTGTTCGGTATTTTGTTTGTGATTTGAATGTGTGCAAGAATGCCTGGCTTTAACTGTGTATTTTATAGGAGTGGGAGGTGGC

TGGGGCACTGGAAGTGAAGGGAGACTGAGTTATGTTTTGTGTTGTTGTTGTTTTTGTTGTTTTCGTTTCTGTTGCTGTCTTAATGGGTAACTTTCTCCCG

TTTGCCCTGTCAGCTGGTCTGACGGATTTAAGAATTTTCATTCTTAAAAGACATTGGATTTCAAAGTTTGAATTCTAGATTAGGACCTTTTCTAACTGTG

AATAAAGTTCTGGTTCTGTTAGTCT
Translation
MAARLATVACALFLLSSALLRLGCRARFAAEPDSDEDGEETVAFPESPPQKPTVFVVVLARNAAHTLPYFLGCLERLDYPKSRMAIW - UNI38570 -

 WAATDHNVDNTTEILREWLKSVQRLYHYVEWRPMNEPE ESYPDEIGPKHWPNSRFSHVMKLRQAALRTAREKWSDYIL FIDVDNFLTNPQTLNLMIV

ENKTIVAPMLESRGLYSNFWCGITPQ GFYKRTPDYLQIREWKRMGCFPVPMVHSTFLIDLRKEASDKLAFYPPHQDYTWTFDDIIVFAFSSRQAG GIQ

MYLCNKEHYGYLPIPLKPHQTLQEDVENLIHVQIEAMI IDHPPMEPSQFVSVVPKYPDKMGFDE IFMINLKRRKDRRDRMLRTLYEQEIEVKIVEAVD

GK KALNTSQLKAWNIEMLPGYRDPYSSRPLTRGEIGCFLSHFSVWKE VIDRELEKTLVIEDDVRFEHQFKRKLMKLMEDIDKAQLDWELI IYIGRKR

MQVKEPEKAVPNVVNLVEADYSYWTLGYAISLEGAQKLVGADPFGKMLPVDEFLPIMYNKHPV VAEYKEYYESRDLKAFSAEPLLIYPTHYTGQPGYLS

DTETSTIWDNETVATDWDRTHSWKSRKQGHIRSTAKNTEALPPPTSLDTVPSRDEL

For any suggestions or comments, please send an email to unitrap@crg.es