Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032715 (Trib3)
Chromosomal location
Chr 2: 152163161 - 152169724 (-)
Description
tribbles homolog 3 (Drosophila) Gene [Source:MGI (curated);Acc:Trib3-001]
RefSeq_dna
NM_175093 
RefSeq_peptide
NP_780302.2 
UniGene
Mm.276018 Mm.412275 
MGI
MGI:1345675 
Uniprot/SWISSPROT
Q8K4K2 
Uniprot/SPTREMBL
A2AS80 Q3UJJ9 
Human Ortholog
ENSG00000101255 (TRIB3)
Omim not available
UniTrap UNI21608
Vector Insertion
Chr 2: 152169064 - 152169592
Public Clones not available
Private Clones OST324148 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22234
Vector Insertion
Chr 2: 152168913 - 152169064
Public Clones not available
Private Clones OST302768 (lexicon) OST242047 (lexicon) OST200212 (lexicon) OST33317 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16840
Vector Insertion
Chr 2: 152165687 - 152165744
Public Clones not available
Private Clones OST453400 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000040312
Sequence
GGAAGAGGCTGCTGCCGAGTACGTGACGGCTGGGGTCTGGCACTAGCGTGCAGGAGACTCCGAGAGCTGCTCAGTTAGGCTGGCGGCGGTCCACGGGCGT

GGGCGCAGGCGGCTCTGAGGCTCCAGGACAAG - UNI21608 - - UNI22234 - ATGCGAGCTACACCTCTGGCTGCTTCTGCTGATGTTTCCTG

CAGGAAGAAACCGTTGGAGTTTGATGACAATATTGATGCCAAGTGTCCAGTCCTAAAACGAGTGAGAGATGAGCCTGAGCCCGGACCACTCCCCAGCCTG

CTGCCCCCCAGCCCACCTCCCGCCTCAGACTTGTCACCTGCTGTGGCCCCTGCAACTCGACTGGGGCCTTATATCCTTTTGGAACGAGAGCAAGGCAGCT

GCAGCTATCGAGCCCTGCACTGCCCCACAGGCACAGAGTACACCTGCAAG - UNI16840 - GTGTACCCTGCCAGCGAGGCCCAGGCGGTGCTGGCA

CCTTATGCCCGGCTGCCTACCCACCAGCATGTGGCCCGTCCCACAGAGGTCCTGCTGGGCTCTCGGCTCCTTTACATCTTTTTCACGAAGACCCATGGGG

ACTTGCACAGCCTGGTGCGCAGCCGCCGCGGTATCCCAGAGTCCGAGGCTGCCGGGCTCTTCCGGCAGATGGCTAGTGCCGTGGCACACTGCCACAAGCA

CGGGCTTGTCTTGCGCGACCTCAAGCTGCGTCGCTTTGTCTTCAGCAACTGTGAGAG GACGAAGCTGGTGCTGGAGAACCTGGAAGATGCCTGCGTGAT

GACTGGATCAGATGACTCTCTGTGGGACAAGCATGCGTGCCCTGCCTACGTGGGACCAGAGATACTCAGCTCCCGGCCATCCTACTCTGGCAAAGCGGCT

GATGTCTGGAGCCTGGGTGTGGCGCTCTTCACCATGCTGGCTGGCAGATACCCATTCCACGACTCTGAGCCAGTCCTGCTCTTTGGCAAGATCCGTAGAG

GGACCTTTGCCCTGCCTGAGGGCCTATCAGCCCCAGCCCGCTGTCTGATCCGCTGTCTCCTCCGCAAGGAACCTTCAGAGCGACTTGTGGCCCTGGGAAT

CCTCTTGCATCCCTGGTTGAGAGAGGATCACGGCCGAGTCTCTCCTCCACAGTCTGACCGAAGGGAGATGGACCAGGTGGTCCCAGATGGGCCACAGCTG

GAGGAGGCTGAGGAAGGGGAGGTGGGGCTGTACGGCTAGGGCCACCTTACTGGCCCCTCAGCTCCAAGGTGTGAGTTGAGTACCTGAGTCTCAGCTTTCT

CCTGACTTTTTGGGCCAAGCTAAACCTTAAGTGCCTTTCTGGAGGAAGAAACAGCCGGCGTGCCTTATTCGTTCCTGTGCCTAGTGGGGTGATGCTCCCT

GAGTGCCACGCCCTGCTCTAGGTGCTGTGAACAGCAAAGGAAAAAGAGGGAGAAATATACCTTGCTGGCCAAGTTGCCACAGTGCCGCATGCTCTCCGGC

CAGCCCCTGCCTTGGGCACGTTTCCTACCGGGGCTGTCTTCTCTGGTGCTGGTTCATGGGACAGTCCCTTTTATCAGTGCCCCAGCTGCCTTCTGTCTTG

TGCCTTTAAACAAAGGAAACATCTCTGTGCCAAAGACCAAAGTCCTCACTCACCATGTGCCTCAGGACCACAAATCAGGCCGGGCTGGGATTGTGGCCTC

CAGGCAGGAGAACCTGTTTGAAGAAGACTTGGCTGTGGGATTCAAGCCAAAAGGATGAGACTCCAATAAAGAGGCATCTGACTCAAGGAATAGTCTGGAA

TAAGGATCCGGGTCTGTTTACCCTGGTAGCCTCCGGCTGAAGCACCAAAGTTGGAGGGGGAGGACCAGGCAGGGTCTGTCCTACTGCCTACAGACAATCT

CAGGCCCTGTTCTGGGGACTTTTAGTACCCAGGCCCACAGTCAGTTTGATGACTTTGGTCTGGTTAAGTGTGTATTTTCATCATGTGCCCAATAAAAGAG

AGCTGTGTGGTTTGATATGTG
Translation
 - UNI21608 - - UNI22234 - MRATPLAASADVSCRKKPLEFDDNIDAKCPVLKRVRDEPEPGPLPSLLPPSPPPASDLSPAVAPATRLGPYIL

LEREQGSCSYRALHCPTGTEYTCK - UNI16840 - VYPASEAQAVLAPYARLPTHQHVARPTEVLLGSRLLYIFFTKTHGDLHSLVRSRRGIPESEA

AGLFRQMASAVAHCHKHGLVLRDLKLRRFVFSNCER RTKLVLENLEDACVMTGSDDSLWDKHACPAYVGPEILSSRPSYSGKAADVWSLGVALFTMLAG

RYPFHDSEPVLLFGKIRRGTFALPEGLSAPARCLIRCLLRKEPSERLVALGILLHPWLREDHGRVSPPQSDRREMDQVVPDGPQLEEAEEGEVGLYG
Transcript ENSMUST00000099213
Sequence
ATGCGAGCTACACCTCTGGCTGCTTCTGCTGATGTTTCCTGCAGGAAGAAACCGTTGGAGTTTGATGACAATATTGATGCCAAGTGTCCAGTCCTAAAAC

GAGTGAGAGATGAGCCTGAGCCCGGACCACTCCCCAGCCTGCTGCCCCCC - UNI22234 - CCCACCTCCCGCCTCAGACTTGTCACCTGCTGTGGC

CCCTGCAACTCGACTGGGGCCTTATATCCTTTTGGAACGAGAGCAAGGCAGCTGCAGCTATCGAGCCCTGCACTGCCCCACAGGCACAGAGTACACCTGC

AAG - UNI16840 - GTGTACCCTGCCAGCGAGGCCCAGGCGGTGCTGGCACCTTATGCCCGGCTGCCTAC - UNI16840 - CACCAGCATGTGG

CCCGTCCCACAGAGGTCCTGCTGGGCTCTCGGCTCCTTTACATCTTTTTCACGAAGACCCATGGGGACTTGCACAGCCTGGTGCGCAGCCGCCGCGGTAT

CCCAGAGTCCGAGGCTGCCGGGCTCTTCCGGCAGATGGCTAGTGCCGTGGCACACTGCCACAAGCACGGGCTTGTCTTGCGCGACCTCAAGCTGCGTCGC

TTTGTCTTCAGCAACTGTGAGAG GACGAAGCTGGTGCTGGAGAACCTGGAAGATGCCTGCGTGATGACTGGATCAGATGACTCTCTGTGGGACAAGCAT

GCGTGCCCTGCCTACGTGGGACCAGAGATACTCAGCTCCCGGCCATCCTACTCTGGCAAAGCGGCTGATGTCTGGAGCCTGGGTGTGGCGCTCTTCACCA

TGCTGGCTGGCAGATACCCATTCCACGACTCTGAGCCAGTCCTGCTCTTTGGCAAGATCCGTAGAGGGACCTTTGCCCTGCCTGAGGGCCTATCAGCCCC

AGCCCGCTGTCTGATCCGCTGTCTCCTCCGCAAGGAACCTTCAGAGCGACTTGTGGCCCTGGGAATCCTCTTGCATCCCTGGTTGAGAGAGGATCACGGC

CGAGTCTCTCCTCCACAGTCTGACCGAAGGGAGATGGACCAGGTGGTCCCAGATGGGCCACAGCTGGAGGAGGCTGAGGAAGGGGAGGTGGGGCTGTACG

GCTAGGGCCACCTTACTGGCCCCTCAGCTCCAAGGTGTGAGTTGAGTACCTGAGTCTCAGCTTTCTCCTGACTTTTTGGGCCAAGCTAAACCTTAAGTGC

CTTTCTGGAGGAAGAAACAGCCGGCGTGCCTTATTCGTTCCTGTGCCTAGTGGGGTGATGCTCCCTGAGTGCCACGCCCTGCTCTAGGTGCTGTGAACAG

CAAAGGAAAAAGAGGGAGAAATATACCTTGCTGGCCAAGTTGCCACAGTGCCGCATGCTCTCCGGCCAGCCCCTGCCTTGGGCACGTTTCCTACCGGGGC

TGTCTTCTCTGGTGCTGGTTCATGGGACAGTCCCTTTTATCAGTGCCCCAGCTGCCTTCTGTCTTGTGCCTTTAAACAAAGGAAACATCTCTGTGCCAAA

GACCAAAGTCCTCACTCACCATGTGCCTCAGGACCACAAATCAGGCCGGGCTGGGATTGTGGCCTCCAGGCAGGAGAACCTGTTTGAAGAAGACTTGGCT

GTGGGATTCAAGCCAAAAGGATGAGACTCCAATAAAGAGGCATCTGACTCAAGGAATAGTCTGGAATAAGGATCCGGGTCTGTTTACCCTGGTAGCCTCC

GGCTGAAGCACCAAAGTTGGAGGGGGAGGACCAGGCAGGGTCTGTCCTACTGCCTACAGACAATCTCAGGCCCTGTTCTGGGGACTTTTAGTACCCAGGC

CCACAGTCAGTTTGATGACTTTGGTCTGGTTAAGTGTGTATTTTCATCATGTGCCCAATAAAAGAGAGCTGTGTGGTTTGATATGTG
Translation
MRATPLAASADVSCRKKPLEFDDNIDAKCPVLKRVRDEPEPGPLPSLLPP - UNI22234 - PTSRLRLVTCCGPCNSTGALYPFGTRARQLQLSSPA

LPHRHRVHLQG - UNI16840 - GVPCQRGPGGAGTLCPAAY - UNI16840 - HQHVARPTEVLLGSRLLYIFFTKTHGDLHSLVRSRRGIPESE

AAGLFRQMASAVAHCHKHGLVLRDLKLRRFVFSNCER RTKLVLENLEDACVMTGSDDSLWDKHACPAYVGPEILSSRPSYSGKAADVWSLGVALFTMLA

GRYPFHDSEPVLLFGKIRRGTFALPEGLSAPARCLIRCLLRKEPSERLVALGILLHPWLREDHGRVSPPQSDRREMDQVVPDGPQLEEAEEGEVGLYG

For any suggestions or comments, please send an email to unitrap@crg.es