Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032727 (Mier3)
Chromosomal location
Chr 13: 112476386 - 112508802 (+)
Description
mesoderm induction early response 1, family member 3 Gene [Source:MGI (curated);Acc:Mier3-001]
RefSeq_peptide
NP_766181.2 
UniGene
Mm.417000 Mm.474778 Mm.31012 
MGI
MGI:2442317 
Uniprot/SWISSPROT
Q3UHF3 
Human Ortholog
ENSG00000155545 (MIER3)
Omim not available
UniTrap UNI17529
Vector Insertion
Chr 13: 112476663 - 112478035
Public Clones not available
Private Clones OST441066 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1777
Vector Insertion
Chr 13: 112481590 - 112493836
Public Clones CA0213 (sanger) CF0172 (sanger) RRR648 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4772
Vector Insertion
Chr 13: 112501989 - 112504448
Public Clones AW0602 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000047412
Sequence
GGAGGTGAGCGGAGAAACCGGGCAGCGGCGGCCGTGCTGGAGCGGGAGCCGGGCGGCCCTCCGAAGCCCCGCAGCCGGCCCGAGAGCCACGGCTCCTCCC

GCGG - UNI17529 - GCTTCCTTTGGAAGTTCGAGCCCAG TTGGGTCTTTGTCTTCTGAGGACCATGACTTTGACCCCACTGCTGAGATGCTAGTT

CATGACTATGATGATGAAAGAACTCTAGAGGAAGAAGAGTTGATGGACGACGGGAAGAACTTCAGCTCTGAAATTGAAGACTTAGAGAAG - UNI1777

 - GAAGGGAACATGCCGCTAGAAGACCTGTTGGCGTTCTACGGCTATGAATCTACAATTCCAGCGGTTGCGAATTCCAGTGCAAACAGCTCCCCAAGTG

AACTTGCAGACGAACTACCAGACATGACTCTAGACAAA GAAGAGATCGCGAAAGACCTGCTGTCCGGCGATGACGAGGAAACTCAGTCTTCCGCTGATG

ATCTGACACCGTCCGTGACTTCTCATGAGACTTCGGAGTTCTTCCCCCGGCCTTTACGAT CAAACACTACATGTGATGGAGACAAGGAGTCCGAGATTG

AGGACGTTGAAACGGACAGTGGTAACTCACCTGAAGATTTGAGAAGG GAAATAATGATTGGTCTAGAGTATCAGGCAGAAATTCCCCCTTATCTTGGCG

AGTACAATGGTGACGACGAGAAAG CTTATGAAAATGAGGACCAGTTACTGTGGCATCCTGGTGTGCTTTTGGAGAGCAAAGTCAAGGAGTACCTTGTTG

AGACCTCATTGAGAACTGGAAATGAAAAAGTCCTAGACAGGATTTCTTCAGGCACACACACCAGGGATAATGAACAG GCATTATACGAACTTCTCAAGT

GTAACCACAATATAAAAGAAGCAATTGAAAGGTACTGCTGTAATGGAAAGGCATCTCAAG GAATGACAGCATGGACGGAAGAGGAGTGCCGAAGCTTTG

AACATGCACTGATGCTTCATGGAAAAGATTTTCATCTCATTCAGAAAGATAAG - UNI4772 - GTGAGGTCTAGAACGGTTGCCGAGTGCGTAGCCT

TCTACTACATGTGGAAGAAATCAGAACGCTATGATTACTTTGCTCAACAGACAAAATTTGGAAAGAAACGCTATAACCATCACCCTGGTGTTAC GGACT

ACATGGATCGTCTCGTAGATGAGACAGAGTCTCTGGGTGGTACCGTCAGTTCTTCAGCCTTAACTTGTAACCGGCCTGAGCCCGTTCCTGATCAGCCGCT

GAACATTCTCAGCTCCTTCACTGCCAGTGACCTGACAG CTTTAACCAACAGTGTAGCAACTGTCTGCAACCCCACCGCTGTGAATTGTCTGGATGACAG

CTTTCCTCCGCTGGCCAACACGCCTCGTGGACACGTCAATCATGTGCCTGTCGTAACGGAAGAGTTACTCACCCTGCCCAGCAATGGTGAAAGTGATTGT

TTTAATTTATTTGAGACTGGATTTTATCACTCAGAGTTAAACCCCATGTGCAGCGAAGAATCCGAAAGACCAGCAAAGAGATTGAAGATGGGCATTGCTG

TCCCCGAATCCTTTATGAATGAGGTTTCTGTAAACAACCTGGGTGTAGACTTTGAAAACCATACACATCACATCACCAGTGCCAAAATGGCTGTCTCTGT

AGCTGACTTTGGCAGTTTGTCTGCCAACGAGACAAACGGATTCATCAATGCCCATAGTCTGCATCAGCACCAGCACGCCGCCCTTCATTCAGAGTGATGG

GAACGGGAAGCCCAGAGACAATGGGTATGCAGTACCAGTAAACTGAAGGGGAGCTATCAGGTTTGCATAGTCTTTCACTGGAAGTTTGAACCTTTTTCAC

TATGACATCAGTGATGTCAGTATGTATAGAACTATATCTTGATTTATCAAGAGTATTTTCATTTTTCAATCCATAAATGTGGAAATGAACTATGATCCGC

AGAGTTGGGAACTAAGATGGAGCTCTGTGGTGCAGCTTTAAGCTCTGCTTCTCCTCATCCCTTAGTACCTCTTCCACGGCCTCCTTTTTTTCTGTTCCCG

CCGCCCTCATCCCAGATTTAAAACCTGTAGACAGAGGCCACCAGCTCAAACCAGCACAGATGTTCAGAACTGATGTGGCCTCTTTTCATGTCAGCTCCTT

TTGCCGTAACGGATGCAGTGGGATCAATGTTTACAGGTACCAACCCCGATCCCTGTTCAATGTAGCATTATTATTATTTTTTTTTGTTTTCTTTATTAAT

AAAAGCAGGGGTAGGTTTCTTTAAACTGCACAAACATGCAAGGATTTTTTTTAAAAACAGAAACTTCTCTCATGTTATTCAACTAGAGCACTTCAGTTTA

CAAAACAGCAAGACCATCTGTCTGGAAGCCGGCGCGAGGAGCTGTGTGCAAATGAAGGAGACACTTGCTTGGATCCTGTTTCAAAATTCCAGACCAGGGC

TACCTTACACAGAATTGGTCATTGTACTGCCGGGGGACTTCTGTGTAAACTTTTTTTTTTCTTTCTTTCTTTTTTTTTTTTTTTTTTTACAAAAAAATTG

GCATTTGAAGATGTGGTATTCATATGGGGTTTTGTCCACCATTGTCAAGATTGTAATATTAAAAATCATACTGGTCACTGGTAATTTAGTTTGTTCCGAG

GCAATTGACTTGCAAGGCACAGTCTACAAAGCCCAGGAAGTTGCCACAGTGGTTTACATTTTGGGACACCTTGTTTGGAGCACTGCAGTTCAAAGTGTTA

ATATACTTAGACTTCTAGATGGTATACATAACGCAGACCCTTGAAGCTACTTTGTTTAGCTCAAATAGTTGGAAAGAAAACTGTGAGTTTCTGTCTGAAG

TAGAATGGTACGTTACCACTTTTAAGTTTTAAAACGTGACAGATGTTCACGTGCATCTCAGACGTGATTTCACTTTTATTCCAAACATGAGTAAGAAGCC

ATTGTCATAGCTTTGACCATTTTTGCTTTATTAGACATGCTCCTTTTAAGTTTTCAGGTGAGTCAAACTCTACAACACAGTGTTAGGATATAAGCTTTAC

TTTTACAGTTAAAACAATTACTTTTTGCACCGTCTTAATTAAATATTTTGATTTTTTTTTTTATTTTCCTAGTTGTGTTGCTGTTTATAAGTGTGAGTCG

CTTCAAGGTCGTGCTGAAGAGTAGGTAGGAGGTAGTGGTCCTAGTGACTGGACGGGAGGGTATTTATTGCACAAACTGTGAACTGCAATGACATCCTTGC

TTTTGGATGGTGTGTATTGTTTTCCTTTGCAGCATTTTAATGAAGATTGCTTTGAAGTGTTTACGCAGTAGCACATTAAGTATAAAATTTAGTTTAGCAC

AGAGGACAAAGGGTAGTTAAATTAATAACTTAAAATCAGTCTTTAACTTATACATCTAAAATTGAGTATTCCTGTATGCACACAGTAAACAATGGGTAGC

CTGGGCTCCATGTTGCTTTCTAATACTCTCCAAGTGGTTAGCTAGCTTTTTATTGCTGTGCTGTGCTAAACTTTGAACCTTGGTTTTTTCGTTCCCTTCA

GTAGACTTTCTTTAATGTAGGAGGATACCGGGCATGTTCTTGCATTGTTAAAACTATATTTTTCACTCTGGGTTTACCGTGGCTGGTCTGTATAAATGAT

TTATACAAAGATAACTGAATGCTAATACCAGTTGCACTTACATGAAAATGCCCATTCTCTTTGGCTGGCACAGTTTATCTATGCATCGCTGGGGTCTTGA

TGTAAGATGGAAACAGTGTTTCTCATCTAGAGTTTTGATTATCAGCAAGTTGAATGGACACTTTAGTTATTTAAATAGAGTTTTGACCAAAATCCAGAAA

AATGATATGAGAGAAATAAATTCCAGCTAGTTTAACAGATTTTTAAATGCTAACTGGATTTTAGCCTCTTAGAGAGTGCTACCTAGCTGGTAACGTTTAC

TTTTAATTCCTTGTTAAAATGAGGCAATAATTTGCAAGATTTTTGTATATATGTGTACAGTAAATTCTTCATATCTTTTTAGACCTAATTCAATATTTTC

TGACTGCTCCTGTCATGTATGATACATTTTTGTGCATGCCTGATGTGACATTCATAAATTGTACCACTATGACTTTATCCATGTAAAATAGCTATTTATT

GAATTTCTTCCAACAGCTGGACTTATTTTTTTGTCTCCATTTGAACATCTTAACAGAGAATTTGTTACTGTTTATTAAAAGAATTGAGTTTG
Translation
 - UNI17529 -  MLVHDYDDERTLEEEELMDDGKNFSSEIEDLEK - UNI1777 - EGNMPLEDLLAFYGYESTIPAVANSSANSSPSELADELP

DMTLDK EEIAKDLLSGDDEETQSSADDLTPSVTSHETSEFFPRPLRS SNTTCDGDKESEIEDVETDSGNSPEDLRR EIMIGLEYQAEIPPYLGEYNG

DDEKA AYENEDQLLWHPGVLLESKVKEYLVETSLRTGNEKVLDRISSGTHTRDNEQ ALYELLKCNHNIKEAIERYCCNGKASQG GMTAWTEEECRSF

EHALMLHGKDFHLIQKDK - UNI4772 - VRSRTVAECVAFYYMWKKSERYDYFAQQTKFGKKRYNHHPGVT TDYMDRLVDETESLGGTVSSSALTC

NRPEPVPDQPLNILSSFTASDLTA ALTNSVATVCNPTAVNCLDDSFPPLANTPRGHVNHVPVVTEELLTLPSNGESDCFNLFETGFYHSELNPMCSEES

ERPAKRLKMGIAVPESFMNEVSVNNLGVDFENHTHHITSAKMAVSVADFGSLSANETNGFINAHSLHQHQHAALHSE
Transcript ENSMUST00000109270
Sequence
GGGGGCGTCGCGGGCCGGCCTGCCCTATAAGGGGCCGAGCCGCCTCTGCCTCCGGGCGGGTGCCTGGCGGGCCGCGGCGGCGGCAGCGGCGGCGGCGGCT

GCGATTGGCTCAGGCGCCCCATCCGGGGACTGGGCTCGGCGCTGCTCGTTCGCCCTAAAGGTACCAATATGGCGGAG - UNI17529 - GCTTCCTTT

GGAAGTTCGAGCCCAG TTGGGTCTTTGTCTTCTGAGGACCATGACTTTGACCCCACTGCTGAGATGCTAGTTCATGACTATGATGATGAAAGAACTCTA

GAGGAAGAAGAGTTGATGGACGACGGGAAGAACTTCAGCTCTGAAATTGAAGACTTAGAGAAG - UNI1777 - GAAGGGAACATGCCGCTAGAAGAC

CTGTTGGCGTTCTACGGCTATGAATCTACAATTCCAGCGGTTGCGAATTCCAGTGCAAACAGCTCCCCAAGTGAACTTGCAGACGAACTACCAGACATGA

CTCTAGACAAA GAAGAGATCGCGAAAGACCTGCTGTCCGGCGATGACGAGGAAACTCAGTCTTCCGCTGATGATCTGACACCGTCCGTGACTTCTCATG

AGACTTCGGAGTTCTTCCCCCGGCCTTTACGAT CAAACACTACATGTGATGGAGACAAGGAGTCCGAGATTGAGGACGTTGAAACGGACAGTGGTAACT

CACCTGAAGATTTGAGAAGG GAAATAATGATTGGTCTAGAGTATCAGGCAGAAATTCCCCCTTATCTTGGCGAGTACAATGGTGACGACGAGAAAG CT

TATGAAAATGAGGACCAGTTACTGTGGCATCCTGGTGTGCTTTTGGAGAGCAAAGTCAAGGAGTACCTTGTTGAGACCTCATTGAGAACTGGAAATGAAA

AAGTCCTAGACAGGATTTCTTCAGGCACACACACCAGGGATAATGAACAG GCATTATACGAACTTCTCAAGTGTAACCACAATATAAAAGAAGCAATTG

AAAGGTACTGCTGTAATGGAAAGGCATCTCAAG GAATGACAGCATGGACGGAAGAGGAGTGCCGAAGCTTTGAACATGCACTGATGCTTCATGGAAAAG

ATTTTCATCTCATTCAGAAAGATAAG - UNI4772 - GTGAGGTCTAGAACGGTTGCCGAGTGCGTAGCCTTCTACTACATGTGGAAGAAATCAGAAC

GCTATGATTACTTTGCTCAACAGACAAAATTTGGAAAGAAACGCTATAACCATCACCCTGGTGTTAC GGACTACATGGATCGTCTCGTAGATGAGACAG

AGTCTCTGGGTGGTACCGTCAGTTCTTCAGCCTTAACTTGTAACCGGCCTGAGCCCGTTCCTGATCAGCCGCTGAACATTCTCAGCTCCTTCACTGCCAG

TGACCTGACAG CTTTAACCAACAGTGTAGCAACTGTCTGCAACCCCACCGCTGTGAATTGTCTGGATGACAGCTTTCCTCCGCTGGCCAACACGCCTCG

TGGACACGTCAATCATGTGCCTGTCGTAACGGAAGAGTTACTCACCCTGCCCAGCAATGGTGAAAGTGATTGTTTTAATTTATTTGAGACTGGATTTTAT

CACTCAGAGTTAAACCCCATGTGCAGCGAAGAATCCGAAAGACCAGCAAAGAGATTGAAGATGGGCATTGCTGTCCCCGAATCCTTTATGAATGAGGTTT

CTGTAAACAACCTGGGTGTAGACTTTGAAAACCATACACATCACATCACCAGTGCCAAAATGGCTGTCTCTGTAGCTGACTTTGGCAGTTTGTCTGCCAA

CGAGACAAACGGATTCATCAATGCCCATAGTCTGCATCAGCACCAGCACGCCGCCCTTCATTCAGAGTGATGGGAACGGGAAGCCCAGAGACAATGGGTA

TGCAGTACCAGTAAACTGAAGGGGAGCTATCAGGTTTGCATAGTCTTTCACTGGAAGTTTGAACCTTTTTCACTATGACATCAGTGATGTCAGTATGTAT

AGAACTATATCTTGATTTATCAAGAGTATTTTCATTTTTCAATCCATAAATGTGGAAATGAACTATGATCCGCAGAGTTGGGAACTAAGATGGAGCTCTG

TGGTGCAGCTTTAAGCTCTGCTTCTCCTCATCCCTTAGTACCTCTTCCACGGCCTCCTTTTTTTCTGTTCCCGCCGCCCTCATCCCAGATTTAAAACCTG

TAGACAGAGGCCACCAGCTCAAACCAGCACAGATGTTCAGAACTGATGTGGCCTCTTTTCATGTCAGCTCCTTTTGCCGTAACGGATGCAGTGGGATCAA

TGTTTACAGGTACCAACCCCGATCCCTGTTCAATGTAGCATTATTATTATTTTTTTTTGTTTTCTTTATTAATAAAAGCAGGGGTAGGTTTCTTTAAACT

GCACAAACATGCAAGGATTTTTTTTAAAAACAGAAACTTCTCTCATGTTATTCAACTAGAGCACTTCAGTTTACAAAACAGCAAGACCATCTGTCTGGAA

GCCGGCGCGAGGAGCTGTGTGCAAATGAAGGAGACACTTGCTTGGATCCTGTTTCAAAATTCCAGACCAGGGCTACCTTACACAGAATTGGTCATTGTAC

TGCCGGGGGACTTCTGTGTAAACTTTTTTTTTTCTTTCTTTCTTTTTTTTTTTTTTTTTTTACAAAAAAATTGGCATTTGAAGATGTGGTATTCATATGG

GGTTTTGTCCACCATTGTCAAGATTGTAATATTAAAAATCATACTGGTCACTGGTAATTTAGTTTGTTCCGAGGCAATTGACTTGCAAGGCACAGTCTAC

AAAGCCCAGGAAGTTGCCACAGTGGTTTACATTTTGGGACACCTTGTTTGGAGCACTGCAGTTCAAAGTGTTAATATACTTAGACTTCTAGATGGTATAC

ATAACGCAGACCCTTGAAGCTACTTTGTTTAGCTCAAATAGTTGGAAAGAAAACTGTGAGTTTCTGTCTGAAGTAGAATGGTACGTTACCACTTTTAAGT

TTTAAAACGTGACAGATGTTCACGTGCATCTCAGACGTGATTTCACTTTTATTCCAAACATGAGTAAGAAGCCATTGTCATAGCTTTGACCATTTTTGCT

TTATTAGACATGCTCCTTTTAAGTTTTCAGGTGAGTCAAACTCTACAACACAGTGTTAGGATATAAGCTTTACTTTTACAGTTAAAACAATTACTTTTTG

CACCGTCTTAATTAAATATTTTGATTTTTTTTTTTATTTTCCTAGTTGTGTTGCTGTTTATAAGTGTGAGTCGCTTCAAGGTCGTGCTGAAGAGTAGGTA

GGAGGTAGTGGTCCTAGTGACTGGACGGGAGGGTATTTATTGCACAAACTGTGAACTGCAATGACATCCTTGCTTTTGGATGGTGTGTATTGTTTTCCTT

TGCAGCATTTTAATGAAGATTGCTTTGAAGTGTTTACGCAGTAGCACATTAAGTATAAAATTTAGTTTAGCACAGAGGACAAAGGGTAGTTAAATTAATA

ACTTAAAATCAGTCTTTAACTTATACATCTAAAATTGAGTATTCCTGTATGCACACAGTAAACAATGGGTAGCCTGGGCTCCATGTTGCTTTCTAATACT

CTCCAAGTGGTTAGCTAGCTTTTTATTGCTGTGCTGTGCTAAACTTTGAACCTTGGTTTTTTCGTTCCCTTCAGTAGACTTTCTTTAATGTAGGAGGATA

CCGGGCATGTTCTTGCATTGTTAAAACTATATTTTTCACTCTGGGTTTACCGTGGCTGGTCTGTATAAATGATTTATACAAAGATAACTGAATGCTAATA

CCAGTTGCACTTACATGAAAATGCCCATTCTCTTTGGCTGGCACAGTTTATCTATGCATCGCTGGGGTCTTGATGTAAGATGGAAACAGTGTTTCTCATC

TAGAGTTTTGATTATCAGCAAGTTGAATGGACACTTTAGTTATTTAAATAGAGTTTTGACCAAAATCCAGAAAAATGATATGAGAGAAATAAATTCCAGC

TAGTTTAACAGATTTTTAAATGCTAACTGGATTTTAGCCTCTTAGAGAGTGCTACCTAGCTGGTAACGTTTACTTTTAATTCCTTGTTAAAATGAGGCAA

TAATTTGCAAGATTTTTGTATATATGTGTACAGTAAATTCTTCATATCTTTTTAGACCTAATTCAATATTTTCTGACTGCTCCTGTCATGTATGATACAT

TTTTGTGCATGCCTGATGTGACATTCATAAATTGTACCACTATGACTTTATCCATGTAAAATAGCTATTTATTGAATTTCTTCCAACAGCTGGACTTATT

TTTTTGTCTCCATTTGAACATCTTAACAGAGAATTTGTTACTGTTTATTAAAAGAATTGAGTTTGAAAGCATAAAAAATCTGCTTTGCAATCGTATGAAG

AAAAACAATGCCTTTATTATCACGTGTTAATAAGCACAATTCTTATAGCAAACGGTGATGAATTCTTTGTTTCTTTCATTTGCCGCAATATTTTCATATG

AACAAACCAAAAATCCATGGTGAGCAGTGGCGGTGTCGGCTGGCCCATCCTGTGTGTCCAGGGCACTCGGAGGATGTGGACGTTGACGAGTGTGACCTGG

TGCTGTGACTGGAGCAATACTTTACTTTCGTCACGTGTGCTTCGCCGTGCTATGCCGGCCTTTTAATGTTTAGTTTTCCTCTTGTCATGGTCAACTGCTG

AATTTACTTGAAGGATGTAGAATACTATTTAAAAAAAAAAAAACACAAAAAACCTAAAGTCTGTACAATTAGGTCAAAGAATTGTGCAATCGCTTCCTTT

TTAATTTTTAAAATTGAAGGTCACAAATATTTGCGATCAGACCTAATAGAGTAGTAGCGCTATTTAATTTAACCAAAGTCTAGTAAATACTTCAACGTTG

AATGTAAGCTAACAACCCGACCACCAAGGAGATTGTCTGCCCAGAGTTTCAAAGCACATTGTCTACGAATGGAAATTGAAATAATTTATAAAATATTGAC

ATTACTATGTTTTTTAAAAAGTTCCTAATTTTTTCACTAAAAGGAGGGAAACTATTAGTTTTATTGTTAAATATGGTAGATATTAATATTCCTCTTAGAT

GACCAGTGATTGCAATTGTCCCAGTTTGAACTAAGTACCCTGTGAGTATGAGGAACTAGTGACAATCAGAACAAGTTTTAGTATCCAGTGTTCAAGAGGA

AGTTGCTATTGTTGCATTGATTTTAATATTTGTACATAAACACTGATTTTTTGAGCATTATTTTGTATTTGTTGTACTTTAATACCTGGTGTACAGTTCC

AGAAATAAAAATCTGGGAATCTG
Translation
 - UNI17529 -  MLVHDYDDERTLEEEELMDDGKNFSSEIEDLEK - UNI1777 - EGNMPLEDLLAFYGYESTIPAVANSSANSSPSELADELP

DMTLDK EEIAKDLLSGDDEETQSSADDLTPSVTSHETSEFFPRPLRS SNTTCDGDKESEIEDVETDSGNSPEDLRR EIMIGLEYQAEIPPYLGEYNG

DDEKA AYENEDQLLWHPGVLLESKVKEYLVETSLRTGNEKVLDRISSGTHTRDNEQ ALYELLKCNHNIKEAIERYCCNGKASQG GMTAWTEEECRSF

EHALMLHGKDFHLIQKDK - UNI4772 - VRSRTVAECVAFYYMWKKSERYDYFAQQTKFGKKRYNHHPGVT TDYMDRLVDETESLGGTVSSSALTC

NRPEPVPDQPLNILSSFTASDLTA ALTNSVATVCNPTAVNCLDDSFPPLANTPRGHVNHVPVVTEELLTLPSNGESDCFNLFETGFYHSELNPMCSEES

ERPAKRLKMGIAVPESFMNEVSVNNLGVDFENHTHHITSAKMAVSVADFGSLSANETNGFINAHSLHQHQHAALHSE
Transcript ENSMUST00000109271
Sequence
GTTCGCCCTAAAGGTACCAATATGGCGGAG - UNI17529 - GCTTCCTTTGGAAGTTCGAGCCCAG TTGGGTCTTTGTCTTCTGAGGACCATGACT

TTGACCCCACTGCTGAGATGCTAGTTCATGACTATGATGATGAAAGAACTCTAGAGGAAGAAGAGTTGATGGACGACGGGAAGAACTTCAGCTCTGAAAT

TGAAGACTTAGAGAAG - UNI1777 - GAAGGGAACATGCCGCTAGAAGACCTGTTGGCGTTCTACGGCTATGAATCTACAATTCCAGCGGTTGCGAA

TTCCAGTGCAAACAGCTCCCCAAGTGAACTTGCAGACGAACTACCAGACATGACTCTAGACAAA GAAGAGATCGCGAAAGACCTGCTGTCCGGCGATGA

CGAGGAAACTCAGTCTTCCGCTGATGATCTGACACCGTCCGTGACTTCTCATGAGACTTCGGAGTTCTTCCCCCGGCCTTTACGAT CAAACACTACATG

TGATGGAGACAAGGAGTCCGAGATTGAGGACGTTGAAACGGACAGTGGTAACTCACCTGAAGATTTGAGAAGG GAAATAATGATTGGTCTAGAGTATCA

GGCAGAAATTCCCCCTTATCTTGGCGAGTACAATGGTGACGACGAGAAAG CTTATGAAAATGAGGACCAGTTACTGTGGCATCCTGGTGTGCTTTTGGA

GAGCAAAGTCAAGGAGTACCTTGTTGAGACCTCATTGAGAACTGGAAATGAAAAAGTCCTAGACAGGATTTCTTCAGGCACACACACCAGGGATAATGAA

CAG GCATTATACGAACTTCTCAAGTGTAACCACAATATAAAAGAAGCAATTGAAAGGTACTGCTGTAATGGAAAGGCATCTCAAG GAATGACAGCATG

GACGGAAGAGGAGTGCCGAAGCTTTGAACATGCACTGATGCTTCATGGAAAAGATTTTCATCTCATTCAGAAAGATAAG - UNI4772 - GTGAGGTC

TAGAACGGTTGCCGAGTGCGTAGCCTTCTACTACATGTGGAAGAAATCAGAACGCTATGATTACTTTGCTCAACAGACAAAATTTGGAAAGAAACGCTAT

AACCATCACCCTGGTGTTAC GGACTACATGGATCGTCTCGTAGATGAGACAGAGTCTCTGGGTGGTACCGTCAGTTCTTCAGCCTTAACTTGTAACCGG

CCTGAGCCCGTTCCTGATCAGCCGCTGAACATTCTCAGCTCCTTCACTGCCAGTGACCTGACAG CTTTAACCAACAGTGTAGCAACTGTCTGCAACCCC

ACCGCTGTGAATTGTCTGGATGACAGCTTTCCTCCGCTGGCCAACACGCCTCGTGGACACGTCAATCATGTGCCTGTCGTAACGGAAGAGTTACTCACCC

TGCCCAGCAATGGTGAAAGTGATTGTTTTAATTTATTTGAGACTGGATTTTATCACTCAGAGTTAAACCCCATGTGCAGCGAAGAATCCGAAAGACCAGC

AAAGAGATTGAAGATGGGCATTGCTGTCCCCGAATCCTTTATGAATGAGGTTTCTGTAAACAACCTGGGTGTAGACTTTGAAAACCATACACATCACATC

ACCAGTGCCAAAATGGCTGTCTCTGTAGCTGACTTTGGCAGTTTGTCTGCCAACGAGACAAACGGATTCATCAATGCCCATAGTCTGCATCAGCACCAGC

ACGCCGCCCTTCATTCAGAGTGATGGGAACGGGAAGCCCAGAGACAATGGGTATGCAGTACCAGTAAACTGAAGGGGAGCTATCAGGTTTGCATAGTCTT

TCACTGGAAGTTTGAACCTTTTTCACTATGACATCAGTGATGTCAGTATGTATAGAACTATATCTTGATTTATCAAGAGTATTTTCATTTTTCAATCCAT

AAATGTGGAAATGAACTATGATCCGCAGAGTTGGGAACTAAGATGGAGCTCTGTGGTGCAGCTTTAAGCTCTGCTTCTCCTCATCCCTTAGTACCTCTTC

CACGGCCTCCTTTTTTTCTGTTCCCGCCGCCCTCATCCCAGATTTAAAACCTGTAGACAGAGGCCACCAGCTCAAACCAGCACAGATGTTCAGAACTGAT

GTGGCCTCTTTTCATGTCAGCTCCTTTTGCCGTAACGGATGCAGTGGGATCAATGTTTACAGGTACCAACCCCGATCCCTGTTCAATGTAGCATTATTAT

TATTTTTTTTTGTTTTCTTTATTAATAAAAGCAGGGGTAGGTTTCTTTAAACTGCACAAACATGCAAGGATTTTTTTTAAAAACAGAAACTTCTCTCATG

TTATTCAACTAGAGCACTTCAGTTTACAAAACAGCAAGACCATCTGTCTGGAAGCCGGCGCGAGGAGCTGTGTGCAAATGAAGGAGACACTTGCTTGGAT

CCTGTTTCAAAATTCCAGACCAGGGCTACCTTACACAGAATTGGTCATTGTACTGCCGGGGGACTTCTGTGTAAACTTTTTTTTTTCTTTCTTTCTTTTT

TTTTTTTTTTTTTTACAAAAAAATTGGCATTTGAAGATGTGGTATTCATATGGGGTTTTGTCCACCATTGTCAAGATTGTAATATTAAAAATCATACTGG

TCACTGGTAATTTAGTTTGTTCCGAGGCAATTGACTTGCAAGGCACAGTCTACAAAGCCCAGGAAGTTGCCACAGTGGTTTACATTTTGGGACACCTTGT

TTGGAGCACTGCAGTTCAAAGTGTTAATATACTTAGACTTCTAGATGGTATACATAACGCAGACCCTTGAAGCTACTTTGTTTAGCTCAAATAGTTGGAA

AGAAAACTGTGAGTTTCTGTCTGAAGTAGAATGGTACGTTACCACTTTTAAGTTTTAAAACGTGACAGATGTTCACGTGCATCTCAGACGTGATTTCACT

TTTATTCCAAACATGAGTAAGAAGCCATTGTCATAGCTTTGACCATTTTTGCTTTATTAGACATGCTCCTTTTAAGTTTTCAGGTGAGTCAAACTCTACA

ACACAGTGTTAGGATATAAGCTTTACTTTTACAGTTAAAACAATTACTTTTTGCACCGTCTTAATTAAATATTTTGATTTTTTTTTTTATTTTCCTAGTT

GTGTTGCTGTTTATAAGTGTGAGTCGCTTCAAGGTCGTGCTGAAGAGTAGGTAGGAGGTAGTGGTCCTAGTGACTGGACGGGAGGGTATTTATTGCACAA

ACTGTGAACTGCAATGACATCCTTGCTTTTGGATGGTGTGTATTGTTTTCCTTTGCAGCATTTTAATGAAGATTGCTTTGAAGTGTTTACGCAGTAGCAC

ATTAAGTATAAAATTTAGTTTAGCACAGAGGACAAAGGGTAGTTAAATTAATAACTTAAAATCAGTCTTTAACTTATACATCTAAAATTGAGTATTCCTG

TATGCACACAGTAAACAATGGGTAGCCTGGGCTCCATGTTGCTTTCTAATACTCTCCAAGTGGTTAGCTAGCTTTTTATTGCTGTGCTGTGCTAAACTTT

GAACCTTGGTTTTTTCGTTCCCTTCAGTAGACTTTCTTTAATGTAGGAGGATACCGGGCATGTTCTTGCATTGTTAAAACTATATTTTTCACTCTGGGTT

TACCGTGGCTGGTCTGTATAAATGATTTATACAAAGATAACTGAATGCTAATACCAGTTGCACTTACATGAAAATGCCCATTCTCTTTGGCTGGCACAGT

TTATCTATGCATCGCTGGGGTCTTGATGTAAGATGGAAACAGTGTTTCTCATCTAGAGTTTTGATTATCAGCAAGTTGAATGGACACTTTAGTTATTTAA

ATAGAGTTTTGACCAAAATCCAGAAAAATGATATGAGAGAAATAAATTCCAGCTAGTTTAACAGATTTTTAAATGCTAACTGGATTTTAGCCTCTTAGAG

AGTGCTACCTAGCTGGTAACGTTTACTTTTAATTCCTTGTTAAAATGAGGCAATAATTTGCAAGATTTTTGTATATATGTGTACAGTAAATTCTTCATAT

CTTTTTAGACCTAATTCAATATTTTCTGACTGCTCCTGTCATGTATGATACATTTTTGTGCATGCCTGATGTGACATTCATAAATTGTACCACTATGACT

TTATCCATGTAAAATAGCTATTTATTGAATTTCTTCCAACAGCTGGACTTATTTTTTTGTCTCCATTTGAACATCTTAACAGAGAATTTGTTACTGTTTA

TTAAAAGAATTGAGTTTG
Translation
MAE - UNI17529 - ASFGSSSPV VGSLSSEDHDFDPTAEMLVHDYDDERTLEEEELMDDGKNFSSEIEDLEK - UNI1777 - EGNMPLEDLLA

FYGYESTIPAVANSSANSSPSELADELPDMTLDK EEIAKDLLSGDDEETQSSADDLTPSVTSHETSEFFPRPLRS SNTTCDGDKESEIEDVETDSGNS

PEDLRR EIMIGLEYQAEIPPYLGEYNGDDEKA AYENEDQLLWHPGVLLESKVKEYLVETSLRTGNEKVLDRISSGTHTRDNEQ ALYELLKCNHNIKE

AIERYCCNGKASQG GMTAWTEEECRSFEHALMLHGKDFHLIQKDK - UNI4772 - VRSRTVAECVAFYYMWKKSERYDYFAQQTKFGKKRYNHHPG

VT TDYMDRLVDETESLGGTVSSSALTCNRPEPVPDQPLNILSSFTASDLTA ALTNSVATVCNPTAVNCLDDSFPPLANTPRGHVNHVPVVTEELLTLP

SNGESDCFNLFETGFYHSELNPMCSEESERPAKRLKMGIAVPESFMNEVSVNNLGVDFENHTHHITSAKMAVSVADFGSLSANETNGFINAHSLHQHQHA

ALHSE
Transcript ENSMUST00000109272
Sequence
GGGGGCGTCGCGGGCCGGCCTGCCCTATAAGGGGCCGAGCCGCCTCTGCCTCCGGGCGGGTGCCTGGCGGGCCGCGGCGGCGGCAGCGGCGGCGGCGGCT

GCGATTGGCTCAGGCGCCCCATCCGGGGACTGGGCTCGGCGCTGCTCGTTCGCCCTAAAGGTACCAATATGGCGGAG - UNI17529 - GCTTCCTTT

GGAAGTTCGAGCCCAG TTGGGTCTTTGTCTTCTGAGGACCATGACTTTGACCCCACTGCTGAGATGCTAGTTCATGACTATGATGATGAAAGAACTCTA

GAGGAAGAAGAGTTGATGGACGACGGGAAGAACTTCAGCTCTGAAATTGAAGACTTAGAGAAG - UNI1777 - GAAGGGAACATGCCGCTAGAAGAC

CTGTTGGCGTTCTACGGCTATGAATCTACAATTCCAGCGGTTGCGAATTCCAGTGCAAACAGCTCCCCAAGTGAACTTGCAGACGAACTACCAGACATGA

CTCTAGACAAA GAAGAGATCGCGAAAGACCTGCTGTCCGGCGATGACGAGGAAACTCAGTCTTCCGCTGATGATCTGACACCGTCCGTGACTTCTCATG

AGACTTCGGAGTTCTTCCCCCGGCCTTTACGAT CAAACACTACATGTGATGGAGACAAGGAGTCCGAGATTGAGGACGTTGAAACGGACAGTGGTAACT

CACCTGAAGATTTGAGAAGG GAAATAATGATTGGTCTAGAGTATCAGGCAGAAATTCCCCCTTATCTTGGCGAGTACAATGGTGACGACGAGAAAG CT

TATGAAAATGAGGACCAGTTACTGTGGCATCCTGGTGTGCTTTTGGAGAGCAAAGTCAAGGAGTACCTTGTTGAGACCTCATTGAGAACTGGAAATGAAA

AAGTCCTAGACAGGATTTCTTCAGGCACACACACCAGGGATAATGAACAG GCATTATACGAACTTCTCAAGTGTAACCACAATATAAAAGAAGCAATTG

AAAGGTACTGCTGTAATGGAAAGGCATCTCAAG AAGGAATGACAGCATGGACGGAAGAGGAGTGCCGAAGCTTTGAACATGCACTGATGCTTCATGGAA

AAGATTTTCATCTCATTCAGAAAGATAAG - UNI4772 - GTGAGGTCTAGAACGGTTGCCGAGTGCGTAGCCTTCTACTACATGTGGAAGAAATCAG

AACGCTATGATTACTTTGCTCAACAGACAAAATTTGGAAAGAAACGCTATAACCATCACCCTGGTGTTAC GGACTACATGGATCGTCTCGTAGATGAGA

CAGAGTCTCTGGGTGGTACCGTCAGTTCTTCAGCCTTAACTTGTAACCGGCCTGAGCCCGTTCCTGATCAGCCGCTGAACATTCTCAGCTCCTTCACTGC

CAGTGACCTGACAG CTTTAACCAACAGTGTAGCAACTGTCTGCAACCCCACCGCTGTGAATTGTCTGGATGACAGCTTTCCTCCGCTGGCCAACACGCC

TCGTGGACACGTCAATCATGTGCCTGTCGTAACGGAAGAGTTACTCACCCTGCCCAGCAATGGTGAAAGTGATTGTTTTAATTTATTTGAGACTGGATTT

TATCACTCAGAGTTAAACCCCATGTGCAGCGAAGAATCCGAAAGACCAGCAAAGAGATTGAAGATGGGCATTGCTGTCCCCGAATCCTTTATGAATGAGG

TTTCTGTAAACAACCTGGGTGTAGACTTTGAAAACCATACACATCACATCACCAGTGCCAAAATGGCTGTCTCTGTAGCTGACTTTGGCAGTTTGTCTGC

CAACGAGACAAACGGATTCATCAATGCCCATAGTCTGCATCAGCACCAGCACGCCGCCCTTCATTCAGAGTGATGGGAACGGGAAGCCCAGAGACAATGG

GTATGCAGTACCAGTAAACTGAAGGGGAGCTATCAGGTTTGCATAGTCTTTCACTGGAAGTTTGAACCTTTTTCACTATGACATCAGTGATGTCAGTATG

TATAGAACTATATCTTGATTTATCAAGAGTATTTTCATTTTTCAATCCATAAATGTGGAAATGAACTATGATCCGCAGAGTTGGGAACTAAGATGGAGCT

CTGTGGTGCAGCTTTAAGCTCTGCTTCTCCTCATCCCTTAGTACCTCTTCCACGGCCTCCTTTTTTTCTGTTCCCGCCGCCCTCATCCCAGATTTAAAAC

CTGTAGACAGAGGCCACCAGCTCAAACCAGCACAGATGTTCAGAACTGATGTGGCCTCTTTTCATGTCAGCTCCTTTTGCCGTAACGGATGCAGTGGGAT

CAATGTTTACAGGTACCAACCCCGATCCCTGTTCAATGTAGCATTATTATTATTTTTTTTTGTTTTCTTTATTAATAAAAGCAGGGGTAGGTTTCTTTAA

ACTGCACAAACATGCAAGGATTTTTTTTAAAAACAGAAACTTCTCTCATGTTATTCAACTAGAGCACTTCAGTTTACAAAACAGCAAGACCATCTGTCTG

GAAGCCGGCGCGAGGAGCTGTGTGCAAATGAAGGAGACACTTGCTTGGATCCTGTTTCAAAATTCCAGACCAGGGCTACCTTACACAGAATTGGTCATTG

TACTGCCGGGGGACTTCTGTGTAAACTTTTTTTTTTCTTTCTTTCTTTTTTTTTTTTTTTTTTTACAAAAAAATTGGCATTTGAAGATGTGGTATTCATA

TGGGGTTTTGTCCACCATTGTCAAGATTGTAATATTAAAAATCATACTGGTCACTGGTAATTTAGTTTGTTCCGAGGCAATTGACTTGCAAGGCACAGTC

TACAAAGCCCAGGAAGTTGCCACAGTGGTTTACATTTTGGGACACCTTGTTTGGAGCACTGCAGTTCAAAGTGTTAATATACTTAGACTTCTAGATGGTA

TACATAACGCAGACCCTTGAAGCTACTTTGTTTAGCTCAAATAGTTGGAAAGAAAACTGTGAGTTTCTGTCTGAAGTAGAATGGTACGTTACCACTTTTA

AGTTTTAAAACGTGACAGATGTTCACGTGCATCTCAGACGTGATTTCACTTTTATTCCAAACATGAGTAAGAAGCCATTGTCATAGCTTTGACCATTTTT

GCTTTATTAGACATGCTCCTTTTAAGTTTTCAGGTGAGTCAAACTCTACAACACAGTGTTAGGATATAAGCTTTACTTTTACAGTTAAAACAATTACTTT

TTGCACCGTCTTAATTAAATATTTTGATTTTTTTTTTTATTTTCCTAGTTGTGTTGCTGTTTATAAGTGTGAGTCGCTTCAAGGTCGTGCTGAAGAGTAG

GTAGGAGGTAGTGGTCCTAGTGACTGGACGGGAGGGTATTTATTGCACAAACTGTGAACTGCAATGACATCCTTGCTTTTGGATGGTGTGTATTGTTTTC

CTTTGCAGCATTTTAATGAAGATTGCTTTGAAGTGTTTACGCAGTAGCACATTAAGTATAAAATTTAGTTTAGCACAGAGGACAAAGGGTAGTTAAATTA

ATAACTTAAAATCAGTCTTTAACTTATACATCTAAAATTGAGTATTCCTGTATGCACACAGTAAACAATGGGTAGCCTGGGCTCCATGTTGCTTTCTAAT

ACTCTCCAAGTGGTTAGCTAGCTTTTTATTGCTGTGCTGTGCTAAACTTTGAACCTTGGTTTTTTCGTTCCCTTCAGTAGACTTTCTTTAATGTAGGAGG

ATACCGGGCATGTTCTTGCATTGTTAAAACTATATTTTTCACTCTGGGTTTACCGTGGCTGGTCTGTATAAATGATTTATACAAAGATAACTGAATGCTA

ATACCAGTTGCACTTACATGAAAATGCCCATTCTCTTTGGCTGGCACAGTTTATCTATGCATCGCTGGGGTCTTGATGTAAGATGGAAACAGTGTTTCTC

ATCTAGAGTTTTGATTATCAGCAAGTTGAATGGACACTTTAGTTATTTAAATAGAGTTTTGACCAAAATCCAGAAAAATGATATGAGAGAAATAAATTCC

AGCTAGTTTAACAGATTTTTAAATGCTAACTGGATTTTAGCCTCTTAGAGAGTGCTACCTAGCTGGTAACGTTTACTTTTAATTCCTTGTTAAAATGAGG

CAATAATTTGCAAGATTTTTGTATATATGTGTACAGTAAATTCTTCATATCTTTTTAGACCTAATTCAATATTTTCTGACTGCTCCTGTCATGTATGATA

CATTTTTGTGCATGCCTGATGTGACATTCATAAATTGTACCACTATGACTTTATCCATGTAAAATAGCTATTTATTGAATTTCTTCCAACAGCTGGACTT

ATTTTTTTGTCTCCATTTGAACATCTTAACAGAGAATTTGTTACTGTTTATTAAAAGAATTGAGTTTGAAAGCATAAAAAATCTGCTTTGCAATCGTATG

AAGAAAAACAATGCCTTTATTATCACGTGTTAATAAGCACAATTCTTATAGCAAACGGTGATGAATTCTTTGTTTCTTTCATTTGCCGCAATATTTTCAT

ATGAACAAACCAAAAATCCATGGTGAGCAGTGGCGGTGTCGGCTGGCCCATCCTGTGTGTCCAGGGCACTCGGAGGATGTGGACGTTGACGAGTGTGACC

TGGTGCTGTGACTGGAGCAATACTTTACTTTCGTCACGTGTGCTTCGCCGTGCTATGCCGGCCTTTTAATGTTTAGTTTTCCTCTTGTCATGGTCAACTG

CTGAATTTACTTGAAGGATGTAGAATACTATTTAAAAAAAAAAAAACACAAAAAACCTAAAGTCTGTACAATTAGGTCAAAGAATTGTGCAATCGCTTCC

TTTTTAATTTTTAAAATTGAAGGTCACAAATATTTGCGATCAGACCTAATAGAGTAGTAGCGCTATTTAATTTAACCAAAGTCTAGTAAATACTTCAACG

TTGAATGTAAGCTAACAACCCGACCACCAAGGAGATTGTCTGCCCAGAGTTTCAAAGCACATTGTCTACGAATGGAAATTGAAATAATTTATAAAATATT

GACATTACTATGTTTTTTAAAAAGTTCCTAATTTTTTCACTAAAAGGAGGGAAACTATTAGTTTTATTGTTAAATATGGTAGATATTAATATTCCTCTTA

GATGACCAGTGATTGCAATTGTCCCAGTTTGAACTAAGTACCCTGTGAGTATGAGGAACTAGTGACAATCAGAACAAGTTTTAGTATCCAGTGTTCAAGA

GGAAGTTGCTATTGTTGCATTGATTTTAATATTTGTACATAAACACTGATTTTTTGAGCATTATTTTGTATTTGTTGTACTTTAATACCTGGTGTACAGT

TCCAGAAATAAAAATCTGGGAATCTG
Translation
MAE - UNI17529 - ASFGSSSPV VGSLSSEDHDFDPTAEMLVHDYDDERTLEEEELMDDGKNFSSEIEDLEK - UNI1777 - EGNMPLEDLLA

FYGYESTIPAVANSSANSSPSELADELPDMTLDK EEIAKDLLSGDDEETQSSADDLTPSVTSHETSEFFPRPLRS SNTTCDGDKESEIEDVETDSGNS

PEDLRR EIMIGLEYQAEIPPYLGEYNGDDEKA AYENEDQLLWHPGVLLESKVKEYLVETSLRTGNEKVLDRISSGTHTRDNEQ ALYELLKCNHNIKE

AIERYCCNGKASQE EGMTAWTEEECRSFEHALMLHGKDFHLIQKDK - UNI4772 - VRSRTVAECVAFYYMWKKSERYDYFAQQTKFGKKRYNHHP

GVT TDYMDRLVDETESLGGTVSSSALTCNRPEPVPDQPLNILSSFTASDLTA ALTNSVATVCNPTAVNCLDDSFPPLANTPRGHVNHVPVVTEELLTL

PSNGESDCFNLFETGFYHSELNPMCSEESERPAKRLKMGIAVPESFMNEVSVNNLGVDFENHTHHITSAKMAVSVADFGSLSANETNGFINAHSLHQHQH

AALHSE

For any suggestions or comments, please send an email to unitrap@crg.es