Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032741 (Tpcn1)
Chromosomal location
Chr 5: 120984169 - 121038682 (-)
Description
two pore channel 1 Gene [Source:MGI Symbol;Acc:MGI:2182472]
RefSeq_dna
NM_145853 
RefSeq_peptide
NP_665852.1 
UniGene
Mm.114054 
MGI
MGI:2182472 
Uniprot/SWISSPROT
Q9EQJ0 
Uniprot/SPTREMBL
Q3UV38 
Human Ortholog
ENSG00000186815 (AC010178.40-202)
Omim not available
UniTrap UNI32310
Vector Insertion
Chr 5: 121035193 - 121038683
Public Clones IST12818D11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9275
Vector Insertion
Chr 5: 121010353 - 121035193
Public Clones XG716 (baygenomics) IST13046F1 (tigm)
Private Clones OST328656 (lexicon) OST68618 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7639
Vector Insertion
Chr 5: 121007956 - 121010224
Public Clones RRR667 (baygenomics)
Private Clones OST359423 (lexicon) OST43380 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22989
Vector Insertion
Chr 5: 121006595 - 121007778
Public Clones not available
Private Clones OST279528 (lexicon) OST232679 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000046426
Sequence
GAGTGACAGGAGTCGGCGGATGCGAAGGCTGGCGCAGCTGCCGCTGTGGCAGCGGTGAGGCGGCGGTGGCGGCTGCTGAGGCTCCGCGCTGGGGATATTG

GCGGCGGCAACTGCGGGCTGAGCTACGCTGTGCAGACCCAGTGCACAGTGCGGGATCCCGGGACGGCGCGT - UNI32310 - ACCTTAGAAGATGCC

TCTGATGGAACAGGCTCTGGGAAGCTTCCCCGGCCCCGTGGCTTTGAACAGGAGCTCAAGCCGGAGGCAGTTTAAAGCCCTGGCCGTTGTATCCTGAGGA

CCGCAGGTCAGGAGAAGATGGCTGTAAGTTTAGATGACGATGTGCCGCTCATCCTGACCTTGGACGAGGCTGAGAGTGCTCCGCTGCCTCCTTCGAACAG

CCTGGGCCAAGAGCAGCTGCCCAGCAAAA - UNI9275 - - UNI32310 - ATGGGGGCAGCCACAGCATCCACAACTCCCAGGTCCCCAGTCTGG

TCTCCGGAGCGGACAGCCCCCCCTCCAGTCCCACCGGACACAACTGGGAGATGAATTATCAAGAGGCGGCAATCTACCTCCAG - UNI7639 - GAAG

GTCAGAACAACGACAAGTTCTTCACCCACCCCAAGGATGCCAGAGCGCTGGCGGCCTACCTCTTCGTCCACAACCACTTCTTCTACATGATGGAGCTGCT

CACGGCCCTGCTCCTGCTGCTGCTGTCGCTGTGCGAGTCCCCCGCTGTCCCCGTGCTCAAGCTGCACACTTAC - UNI22989 - GTCCACGCCACGC

TGGAACTCTTTGCCCTCATGGTGGTGGTATTTGAACTCTGCATGAAATTGCGGTGGCTGGGCTTCCACACGTTCGTCCGGCACAAACGTACCATGGTCAA

G ACGTCCGTCCTCGTGGTGCAGTTCATCGAGGCCATTGTGGTGCTGGTTCGGCAGACGTCCCACGTGCGGGTGACCCGGGCACTACGCTGCATTTTCCT

GGTGGACTGTCGCTACTGTGGCGGTGTACGGCG CAACCTGCGGCAGATCTTCCAGTCTCTCCCACCCTTCATGGACATCCTCCTGTTGCTGCTCTTCTT

TATGATCATCTTTGCCATCCTCG GTTTCTACTTATTCTCCACAAATCCTTCCGACCCC TACTTCAGCACCCTGGAGAACAGCATCGTCAACCTGTTCG

TTCTCCTGACCACAGCCAA CTTTCCAGATGTCATGATGCCCTCCTACTCCCGGAACCCCTGGTCCTGCGTCTTCTTCATTGTATACCTCTCCATTGAGC

TGTACTTCATCATGAACCTG CTCCTGGCCGTGGTGTTCGACACCTTCAACGACATTGAAAAGCACAAGTTCAAGTCTTTGCTGCTGCACAAACGGACCG

CCATCCAGCATGCCTACGGCCTGCTTGCCAGCCAACGG AGGCCGGCTGGCATCTCCTACAGGCAGTTCGAAGGCTTAATGCGCTTCTACAAGCCCCGGA

TGAGTGCAAGGGAACGCTTCCTGACTTTCAAGGCCTTGAACCAGAGCAACACGCCTCTGCTCAG CCTGAAGGACTTCTATGATATTTACGAAGTCGCTG

CTCTGCAGTGGAAG GCAAAGAGAAACAGACAGCATTGGTTTGATGAGCTCCCCCGGACAGCCTTCCTCATCTTCAAAG GGATTAACATCCTTGTGAAT

TCCAAGGCCTTCCAGTATTTCATGT ACTTGGTGGTGGCTGTCAACGGTGTCTGGATCCTGGTGGAGACATTCATGTTGAAAG GTGGGAATTTCACCTC

AAAGCATGTGCCCTGGAGTTACCTCGTGTTTCTTACCA TCTATGGAGTTGAACTGTTCATGAAGGTGGCTGGCCTGGGCCCTGTGGAGTACCTGTCCTC

TGGATGGAACCT GTTCGATTTCTCGGTCACGGCATTCGCCTTCCTGGGACTGCTCGCACTGACGCTCAACATGGAACCCTTCTATTTCATTGTGGTCCT

GCGTCCCCTTCAGCTGCTGAG GTTATTTAAACTGAAGAAACGCTACCGCAACGTGTTGGACACCATGTTTGAGCTGCTGCCGCGGATGGCCAG CCTTG

GCCTCACGCTGCTCACCTTCTACTATTCCTTCGCCATCGTGGGCATGGAGTTCTTCAACGGGCGGCTGACCCCCAACTGCTGCAA CACCAGCACAGTGG

CCGACGCCTACCGGTTCATCAACCACACTGTGGGCAATAAGACCAAGGTAGAGGAAGGCTACTACTATCTCAACAACTTTGACAACATCCTCAACAGCTT

CG TGACCTTGTTTGAGCTCACCGTTGTCAACAATTGGTACATCATCATG GAAGGCGTCACCTCGCAGACGTCCCACTGGAGCCGCCTGTACTTCATGA

CCTTTTACATAGTGACCATG GTGGTGATGACCATTATCGTGGCCTTCATCCTGGAGGCCTTCGTCTTCCGCATGAACTACAGCCGCAAGAGCCAGGACT

CGGAAG TGGACAGTGGCATCGTCATCGAGAAGGAAATGTCCAAGGAGGAGCTTATGGCCGTCCTGGAGCTTTATCGTGAGGAGCGAGGCACCTCCTCTG

ACGTGACCCGGCTGCTGGACACCCTCTCTCAGATGGAGAAATACCAG CAAAATTCCATGGTGTTTCTGGGACGGCGATCGAGAACCAAAAGTGACCTGA

GTCTGAAGATGTACCAGGAGGAGATCCAG GAGTGGTACGAGGAGCATGCCCGGGAACAGGAGCAGCAGAAGCTCAGGGGCAGCGTGCCCGGCCCTGCAG

CCCAGCAGCCCCCTGGCAGTCGCCAGCGCTCCCAGACTGTCACCTAGCTGGGTTTCGTCAAGCCAGCCTCTTCTATGCAATAACACCATAGTATTATGTA

CTAGGACGTATGGGAACCATGTGTGTATGTAGACACACTCATATATATGCACATATTTACACAGAGACAGAAAAGAGACTATAGCCAGGGTCCGTTCCAG

CCACCTCGCTCTGTCTTCCTGAGCTCCAGAAATAACCAGCTTAGGCTGGAGGCCCAGGCCTGGCGGAGCTCTCGTCCTACCATGGAAAACTCTGGAAGCC

CTCTGCTCAAGAAGCCCCTTAAATAGGCTATCTCGTCTCAGCAATGCCGGCTTTCCCCGGGGAGGGATGGGGGGAGCTTGACCGCCTCCCTACTGCGGCC

TCCAGCTTCGTCCCTACCTGAACCCCAGCCAACACAGGTGTCTGTGTCTGGTATGAGGATCAAAACCACTAGGAAGAAACCCCACACCCTGCAGGATGAC

ATCTATCAATGACAAAAGTGTTAGAAGGTTCCCTTGAGGGAGACAGAAGAGCTTACTCTCTCAGGCTCCCAGTCCTTTCTTGTTGCTGGAACCCTACCAC

AACTCCCCCACCCCCACCCCCGGGAACCCCCACCCCCACCCCCGGCAGGATCCCTCCATGCAGGAGAAAGCCAACCAGAGGCCCTGGGAATTTGACTTGC

TCAGGGGAGTTCATTTGAACTGGTGCTGAAGGCAGCCCCCCTCACCAACCACACTTTCACACTGCCTCCTCCAAGATTCTCATAAGCTAGGTGGGTAGGG

GTGGCGAGTCAGGTCAGGTGACTTGTGGGAGTTCTTTTGAGGCCACCATAGTATATGGTGGCAGAGCGATGGAGCCCTGCTGTGTTGTCCACAAGGGGCT

GAAGGTGGGCAGGGCCCGAAGTTGCCTAGCACCCCCACCCCCCCACCCCTGCGCACTCCCTCCAGGCTAACCTGGCCTTCCAAACCTGCTGTTGCTTGGG

AGTTGGAGTGGGCAGGCACAGCCCCCCCCTCCTGTTCTCCCAGCCGCAGAACCAGGGGTCAAGCTGGAAAGCGGATGTTTTTACTTTAAATAAAGCACAG

TTGCCCCCCCCCCCCCAATACATACACTATCCCCCAGGAAAAACCTCTGGTTTCCACAGAGAGTCAGGAGACTGGCCAAGTCCCTTCCACTTCAAAGAGC

TCTTGGCCTCCACTTGGACTCCAGTTCCCAACCCTGAGAAGCAGTTTCATTTCCATAGCCGGTTGCCTTAGCTTCTTTGTGTGTGAGGGGCATTTTGGAA

GCAGAAAGAGGGGAGGCCTATAAAGAGGGCGGTGGGGGGGGGGAGGCTCTGAGCAACTGCCTGGTTCTAGGCCCCTTCCTCTACCCCAGGTACCCTCAGC

CTAGGGGAGCAGGCTCAGGTGGAAGGGACTGGTCTTGGGCCCCATGTAGAGGTACTAAAACCCCTGGGTCTAGCACATACCAGCCAGGTGCCTGAGCAAG

ACAGGGCCCTCAGGCCAAACTGTAGCCCCACAGAGTCACCTTTGAGCACACACCAAGCTGACCCTCAAACTTGCTAGCCAGGCAGGGAACAGACTGTGTC

GCCCAGGGCTGTAAGCTGAGACCCCTGGGATCCCTGTCTAAGCTAGATGCCCCTTCCCTCCATTCAGCAGAGTGAGAACTAGTGGCTCCGTGTCACAGCC

TAGCAGGGGCAGCTACGGAACCACCACGCTGCTTCTCCCGAGTGGGGATAGGGCACTCTGTGGGAACCACCACGCTGCTTCTCCCGAGTGGGGATAGGGC

ACTCTGTGGGAACAGTGTCCGGCCCCTCCCTCTCGCTTCTCCACCCCCTCCACCCCAGCCTTACTCCACACCGTGCAGACAATCATTTTGTATGGGTTAA

GAGCCACGTCGTCGGAAGGTTTTATACAGTGATTTGTTACCTAGGAACGCACTGTGCCCAGATTTCTGGTGTGCCAATAAAAGAGCCTCTGCTTT
Translation
 - UNI32310 - MAVSLDDDVPLILTLDEAESAPLPPSNSLGQEQLPSKN - UNI9275 - - UNI32310 - NGGSHSIHNSQVPSLVSGADSP

PSSPTGHNWEMNYQEAAIYLQ - UNI7639 - EGQNNDKFFTHPKDARALAAYLFVHNHFFYMMELLTALLLLLLSLCESPAVPVLKLHTY - UNI2

2989 - VHATLELFALMVVVFELCMKLRWLGFHTFVRHKRTMVK TSVLVVQFIEAIVVLVRQTSHVRVTRALRCIFLVDCRYCGGVRR RNLRQIFQS

LPPFMDILLLLLFFMIIFAILG GFYLFSTNPSDP YFSTLENSIVNLFVLLTTAN NFPDVMMPSYSRNPWSCVFFIVYLSIELYFIMNL LLAVVFDT

FNDIEKHKFKSLLLHKRTAIQHAYGLLASQR RPAGISYRQFEGLMRFYKPRMSARERFLTFKALNQSNTPLLS SLKDFYDIYEVAALQWK AKRNRQH

WFDELPRTAFLIFKG GINILVNSKAFQYFMY YLVVAVNGVWILVETFMLKG GGNFTSKHVPWSYLVFLTI IYGVELFMKVAGLGPVEYLSSGWNL 

LFDFSVTAFAFLGLLALTLNMEPFYFIVVLRPLQLLR RLFKLKKRYRNVLDTMFELLPRMAS SLGLTLLTFYYSFAIVGMEFFNGRLTPNCCN NTST

VADAYRFINHTVGNKTKVEEGYYYLNNFDNILNSFV VTLFELTVVNNWYIIM EGVTSQTSHWSRLYFMTFYIVTM VVMTIIVAFILEAFVFRMNYSR

KSQDSEV VDSGIVIEKEMSKEELMAVLELYREERGTSSDVTRLLDTLSQMEKYQ QNSMVFLGRRSRTKSDLSLKMYQEEIQ EWYEEHAREQEQQKLR

GSVPGPAAQQPPGSRQRSQTVT

For any suggestions or comments, please send an email to unitrap@crg.es