Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032745 (Gpbp1)
Chromosomal location
Chr 13: 112215890 - 112280236 (-)
Description
GC-rich promoter binding protein 1 Gene [Source:MGI (curated);Acc:Gpbp1-002]
RefSeq_dna
NM_028487 
RefSeq_peptide
NP_001116435.1 NP_082763.3 
UniGene
Mm.409347 Mm.57286 Mm.399413 
MGI
MGI:1920524 
Uniprot/SWISSPROT
Q6NXH3 
Human Ortholog
ENSG00000062194 (GPBP1)
Omim not available
UniTrap UNI4031
Vector Insertion
Chr 13: 112279925 - 112280048
Public Clones AQ0490 (sanger) AR1195 (sanger) RRF014 (baygenomics) RRO334 (baygenomics)
W192C01 (ggtc) P006B04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23500
Vector Insertion
Chr 13: 112278579 - 112279925
Public Clones P133H08 (ggtc) P101D02 (ggtc) P131E09 (ggtc) D022G04 (ggtc) P142H06 (ggtc)
PSTVU01.H24D (vanderbilt) IST14638B3 (tigm) IST14186D3 (tigm)
Private Clones OST256035 (lexicon) OST198213 (lexicon) OST197879 (lexicon) OST85176 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI699
Vector Insertion
Chr 13: 112257179 - 112277630
Public Clones CA0181 (sanger) DC0005 (sanger) AM0517 (sanger) AE0175 (sanger)
YHA328 (baygenomics) RRM010 (baygenomics) LRY034 (baygenomics) Ex335 (baygenomics)
M124E10 (ggtc) W036A07 (ggtc)
Private Clones OST370964 (lexicon) OST281232 (lexicon) OST253400 (lexicon) OST198301 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7503
Vector Insertion
Chr 13: 112257058 - 112257179
Public Clones RRR064 (baygenomics) RRJ146 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23348
Vector Insertion
Chr 13: 112243705 - 112257058
Public Clones IST14402F12 (tigm) IST14337E12 (tigm)
Private Clones OST262748 (lexicon) OST127740 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21418
Vector Insertion
Chr 13: 112239208 - 112243231
Public Clones not available
Private Clones OST331275 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9203
Vector Insertion
Chr 13: 112238164 - 112239140
Public Clones RRC094 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16482
Vector Insertion
Chr 13: 112228333 - 112229311
Public Clones not available
Private Clones OST460113 (lexicon) OST458577 (lexicon)
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7739
Vector Insertion
Chr 13: 112226793 - 112228164
Public Clones RRN067 (baygenomics)
Private Clones OST351477 (lexicon)
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28265
Vector Insertion
Chr 13: 112223859 - 112226604
Public Clones not available
Private Clones OST35740 (lexicon)
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2920
Vector Insertion
Chr 13: 112216860 - 112223755
Public Clones AD0438 (sanger) AW0137 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16429
Vector Insertion
Chr 13: 112216139 - 112216860
Public Clones not available
Private Clones OST461482 (lexicon) OST385774 (lexicon) OST379927 (lexicon) OST358227 (lexicon)
OST337413 (lexicon) OST332802 (lexicon) OST325647 (lexicon) OST51866 (lexicon)
OST40075 (lexicon) OST38891 (lexicon) OST34865 (lexicon)
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000091236
Sequence
CGGCTCCGCCCAGTGGGTTCGTTTGCACCGCGGCTTCCGCACCCTTTCTTCCTCCTCTTTTCCCCTCGCCCCGCCTCCCTCCTCTTACTTCTCAACCTCT

CCGCTGCGTCCCCCCTCCCTCGCCACCTTCCACGATCTCGCGAGACTTGGCCCAGAACATTGCGGATCGGGTCGGCGCCATTTTGGGACTGAGACTGGTT

GTGGGGGAGGGAAAAGCGGCAAAAGGGGATTATTCAAAGTACCGAAAACCTCCTCCCGGGATCGAGCGCAGCGGCACCCCCAGGCCAGGGGCACCTCTGG

TGGGGCAGAAG - UNI4031 - - UNI23500 - GTGGTTGAATTTGGCGTATGAAGATCATCATCTAGGTTTTGTTTAAAAGGCCCCGGATATTTC

AAGTGGCCATTTTGGAATTACAGTTTTGTTTTTGTTTTGGGCAATTTTGCTCCAGAAGTTCATTAAAATTGACAAGAATCATCTCTGAAGTGAATTGATA

GTAGTGAACAAATTCAACGAGCTACTAAAAGTCCCAGCCATTTCTTCAGTATTTTGGGTCAAACGGATTATATAAGTGGTTAAAGCATTTCATCTGGTGT

TATTTTTGTCTCTTTCCCCTCTCCTGTTTGTGTTCTTCAGCCAAAACTGTAAGATATGTTTGATTTGTGTACCAAGTAGTTTCAGCAGTTTCAAATTACT

GTTTAAATATTGCTGAAGTTTTGTGGCAGTTCTTTTTACCTTTATTAAAAGTTTTAGTAATTTTTGACTTCAGCTTTTTTCATATTACAATGGGACAGCT

TTTCTAAATGAAGACATTGAAAGAATACAGCGTTTTTTTCTTTTTATCTTTTATTTACTTGGGAATGTAAGATGTTCCATTTTCACACCAGCATGGTAGT

ATTGAGATAGCTATTTGTCTATACACGCTGATGTTTAGAAGTAATCTTCAGATGTGAAATTTTTCTTTTTGTTTCTGCTTTTTGGCACATAAATTGGCTA

TTTCTTCTGGAGTGGATAAGTACAACAGTGACAAATACATGGAACAGTAAAGAAGACCTTGCTCTTAAATCCAAGGAACCTGGCTAACTCTGGATCTGAC

CATATGAAAACTTCAAAGTAAATATGGGTAGCTGACTTCAAGTAACTCTATGTCAAATAGTCATAGGTTAAGTATCTTCAAAGAACTTGGATATTTCAGA

GGATACAAAATAAAAAAACAAACTGGAAAACATAAAGCTTATAGAGAAGAAATCAACACCTTCTTGTGCAGTCCTTTTGGAATTT - UNI699 - - U

NI7503 - GGACTTGCCATGAGGTGTTGAAGCCTTGTTTCACTGAGTTGGAGAGACTGGACCTAAATGGCGCAGCATGACTTTGCTCCAGCCTGGCTTA

ATTTTCCTACTCCTCCATCATCAACAAAG - UNI7503 - - UNI23348 - TCATCATTGAATTTTGAGAAGCACTCTGAAAATTTTTCATGGACA

GAAAATCGTTATGATGTGAGTCGTCGACGACACAATTCTTCAGATGGCTTTGATTCTGGTATTGGACGTCCTAATGGAG GTAATTTTGGGAGGAAAGAG

AAAAATGGATGGCGTACGCATGGCAGAAATGGTACAGAAAACATAAATCATCGTGGGGGATACCATGGTGGAAATTCCCGTTCTCGTAGCAGTATTTTCC

ATTCTGGAAAAAGCCAAGGACTACATGAAAACAGCATCCCTGACAATGAAACTGGGAGGAAAGAAGACAAAAGAGAACGCAGACAGTTTGAGGCTGAGGA

TTTT - UNI21418 - CCATCTTTAAATCCTGAATATGAGAGAGAACCAAATCAGAATAAATCTTTAGCTGCGGGTGTTTGGG - UNI9203 - AC

TATCCCCCGAATCCTAAATCTAGAACTCCAAGAATGCTGGTCATTAAGAAAGGTAATACAAAAGACTTACAGCTATCTGGATTCCCAGTAGCAGGAAACC

TCCAGTCACAGCCAGTTAAGAATGGAACTGGTCCAAGTGTTTATAAAGGCTTAGTCCCCAAACCTGCTGTTCCACCTACAAAA CCTACACAATGGAAAA

GCCAAACTAAAGAAAACAAAGTCGGGACTTCTTTTTCTCATGAATCTACATATGGTGTTGGCAACTTTAATACTTTTAAGTCAACGGCCAAGAATATTAG

TCCATCAACAAATTCAGTGAAAGAG - UNI16482 - TGTAATCGTTCAAATTCTTCTTCGCCTGTTGACAAACTTAATCAGCAGCCTCGTTTAACTA

AACTGACACGAATGCGCAGCGATAAAAAGAGTGAATTTTTGAAAGCATTGAAAAGGGACAGAGTGGAGGAGGAACATGAAGATGAAAGTCATGCTGGCTC

AGAGAAG - UNI7739 - GACGACGACTCATTTAATTTGCATAACAGCAATACTACTCACCAAGAAAGAGATATAAACAGAAACTTTGATGAAAATGA

AATTCCACAGGAGAACGGCAATGCCTCGATGATTTCTCAACAGATCATTCGTTCTTCGACTTTTCCACAAACTGATGTTCTTTCCAGTTCACTAGAGGCA

GAACACAG - UNI28265 - ATTATTAAAAGAAATGGGCTGGCAGGAAGACAGTGAAAATGATGAAACATGTGCTCCCTTAACTGAGGATGAAATGAG

AGAATTCCAAGTTATTAGTGAACAG - UNI2920 - - UNI16429 - TTACAGAAGAATGGTCTGAGAAAAAATGGTATTTTGAAAAATGGCCTGA

TCTGTGACTTCAAGTTTGGACCCTGGAAAAACAGCACTTTCAAACCCACAATTGAGAATGATGACACAGAGACAAGTAGCAGCGACACGTCGGATGATGA

CGATGTGTGAAGGAGATCCTCACAGCTTTAGAAATGTTAGTGTGATACATCTCTCATGCAGTTTGGGGTGAATTGTAAAAATGAAGAACTATAATTTATG

TAGTGAACCTACCCCATTAGAAGATGATTTTTTGGGGGACTTCGATATGAAGAAAACCAAGAATGTTGTGTTGGGCTGTGTTGAACATTATTTCTTTGTA

AATGAATGTTGTAGAAATGAGGACTTTGGTTGATCCAACATTGACTTTCTTCATCACTGCAGCATTTCTCTTGACTAGCAATGTGACGATGTAACAAATG

AGATTTTCTCATTTAATAATAAAAAATTGTGTGATGTTTTGCAAAGCTTCTGTCTTAAAATGTTCAGGTCTTAAGGTACAAGGCAGCTTACAGTTTTGCT

TGCAGAGTCCTATCTTTTTCAAACTGTGGAAATCTTCAACTCTACGTGTGCACCTCCTTATCCACTCCCCCTAAAACAAAACAACAGCAAAAAGGAAAAT

GTAGCATGTTGGCTAAAACCGGAGCAGAGTGACTAAAACATTAGCTTCTTGAACTCAACTCTTGTACTAAG
Translation
 - UNI4031 - - UNI23500 -  - UNI699 - - UNI7503 - MAQHDFAPAWLNFPTPPSSTK - UNI7503 - - UNI23348 - SSL

NFEKHSENFSWTENRYDVSRRRHNSSDGFDSGIGRPNGG GNFGRKEKNGWRTHGRNGTENINHRGGYHGGNSRSRSSIFHSGKSQGLHENSIPDNETGR

KEDKRERRQFEAEDF - UNI21418 - PSLNPEYEREPNQNKSLAAGVWD - UNI9203 - DYPPNPKSRTPRMLVIKKGNTKDLQLSGFPVAGNL

QSQPVKNGTGPSVYKGLVPKPAVPPTK PTQWKSQTKENKVGTSFSHESTYGVGNFNTFKSTAKNISPSTNSVKE - UNI16482 - CNRSNSSSPVD

KLNQQPRLTKLTRMRSDKKSEFLKALKRDRVEEEHEDESHAGSEK - UNI7739 - DDDSFNLHNSNTTHQERDINRNFDENEIPQENGNASMISQQI

IRSSTFPQTDVLSSSLEAEHR - UNI28265 - RLLKEMGWQEDSENDETCAPLTEDEMREFQVISEQ - UNI2920 - - UNI16429 - LQKN

GLRKNGILKNGLICDFKFGPWKNSTFKPTIENDDTETSSSDTSDDDDV
Transcript ENSMUST00000109274
Sequence
GGACAGCTTTTCTAAATGAAGACATTGAAAGAATACAGCGTTTTTTTCTTTTTATCTTTTATTTACTTGGGAATGTAAGATGTTCCATTTTCACACCAGC

ATGGTAGTATTGAGATAGCTATTTGTCTATACACGCTGATGTTTAGAAGTAATCTTCAGATGTGAAATTTTTCTTTTTGTTTCTGCTTTTTGGCACATAA

ATTGGCTATTTCTTCTGGAGTGGATAAGTACAACAGTGACAAATACATGGAACAGTAAAGAAGACCTTGCTCTTAAATCCAAGGAACCTGGCTAACTCTG

GATCTGACCATATGAAAACTTCAAAGTAAATATGGGTAGCTGACTTCAAGTAACTCTATGTCAAATAGTCATAGGTTAAGTATCTTCAAAGAACTTGGAT

ATTTCAGAGGATACAAAATAAAAAAACAAACTGGAAAACATAAAGCTTATAGAGAAGAAATCAACACCTTCTTGTGCAGTCCTTTTGGAATTT - UNI6

99 - - UNI7503 - GGACTTGCCATGAGGTGTTGAAGCCTTGTTTCACTGAGTTGGAGAGACTGGACCTAAATGGCGCAGCATGACTTTGCTCCAGC

CTGGCTTAATTTTCCTACTCCTCCATCATCAACAAAG - UNI7503 - - UNI23348 - TCATCATTGAATTTTGAGAAGCACTCTGAAAATTTTT

CATGGACAGAAAATCGTTATGATGTGAGTCGTCGACGACACAATTCTTCAGATGGCTTTGATTCTGGTATTGGACGTCCTAATGGAG GTAATTTTGGGA

GGAAAGAGAAAAATGGATGGCGTACGCATGGCAGAAATGGTACAGAAAACATAAATCATCGTGGGGGATACCATGGTGGAAATTCCCGTTCTCGTAGCAG

TATTTTCCATTCTGGAAAAAGCCAAGGACTACATGAAAACAGCATCCCTGACAATGAAACTGGGAGGAAAGAAGACAAAAGAGAACGCAGACAGTTTGAG

GCTGAGGATTTT - UNI21418 - CCATCTTTAAATCCTGAATATGAGAGAGAACCAAATCAGAATAAATCTTTAGCTGCGGGTGTTTGGG - UNI9

203 - ACTATCCCCCGAATCCTAAATCTAGAACTCCAAGAATGCTGGTCATTAAGAAAGGTAATACAAAAGACTTACAGCTATCTGGATTCCCAGTAGC

AGGAAACCTCCAGTCACAGCCAGTTAAGAATGGAACTGGTCCAAGTGTTTATAAAGGCTTAGTCCCCAAACCTGCTGTTCCACCTACAAAA CCTACACA

ATGGAAAAGCCAAACTAAAGAAAACAAAGTCGGGACTTCTTTTTCTCATGAATCTACATATGGTGTTGGCAACTTTAATACTTTTAAGTCAACGGCCAAG

AATATTAGTCCATCAACAAATTCAGTGAAAGAG - UNI16482 - TGTAATCGTTCAAATTCTTCTTCGCCTGTTGACAAACTTAATCAGCAGCCTCG

TTTAACTAAACTGACACGAATGCGCAGCGATAAAAAGAGTGAATTTTTGAAAGCATTGAAAAGGGACAGAGTGGAGGAGGAACATGAAGATGAAAGTCAT

GCTGGCTCAGAGAAG - UNI7739 - GACGACGACTCATTTAATTTGCATAACAGCAATACTACTCACCAAGAAAGAGATATAAACAGAAACTTTGAT

GAAAATGAAATTCCACAGGAGAACGGCAATGCCTCGATGATTTCTCAACAGATCATTCGTTCTTCGACTTTTCCACAAACTGATGTTCTTTCCAGTTCAC

TAGAGGCAGAACACAG - UNI28265 - ATTATTAAAAGAAATGGGCTGGCAGGAAGACAGTGAAAATGATGAAACATGTGCTCCCTTAACTGAGGAT

GAAATGAGAGAATTCCAAGTTATTAGTGAACAG - UNI2920 - - UNI16429 - TTACAGAAGAATGGTCTGAGAAAAAATGGTATTTTGAAAAA

TGGCCTGATCTGTGACTTCAAGTTTGGACCCTGGAAAAACAGCACTTTCAAACCCACAATTGAGAATGATGACACAGAGACAAGTAGCAGCGACACGTCG

GATGATGACGATGTGTGAAGGAGATCCTCACAGCTTTAGAAATGTTAGTGTGATACATCTCTCATGCAGTTTGGGGTGAATTGTAAAAATGAAGAACTAT

AATTTATGTAGTGAACCTACCCCATTAGAAGATGATTTTTTGGGGGACTTCGATATGAAGAAAACCAAGAATGTTGTGTTGGGCTGTGTTGAACATTATT

TCTTTGTAAATGAATGTTGTAGAAATGAGGACTTTGGTTGATCCAACATTGACTTTCTTCATCACTGCAGCATTTCTCTTGACTAGCAATGTGACGATGT

AACAAATGAGATTTTCTCATTTAATAATAAAAAATTGTGTGATGTTTTGC
Translation
 - UNI699 - - UNI7503 - MAQHDFAPAWLNFPTPPSSTK - UNI7503 - - UNI23348 - SSLNFEKHSENFSWTENRYDVSRRRHNSS

DGFDSGIGRPNGG GNFGRKEKNGWRTHGRNGTENINHRGGYHGGNSRSRSSIFHSGKSQGLHENSIPDNETGRKEDKRERRQFEAEDF - UNI21418

 - PSLNPEYEREPNQNKSLAAGVWD - UNI9203 - DYPPNPKSRTPRMLVIKKGNTKDLQLSGFPVAGNLQSQPVKNGTGPSVYKGLVPKPAVPPT

K PTQWKSQTKENKVGTSFSHESTYGVGNFNTFKSTAKNISPSTNSVKE - UNI16482 - CNRSNSSSPVDKLNQQPRLTKLTRMRSDKKSEFLKAL

KRDRVEEEHEDESHAGSEK - UNI7739 - DDDSFNLHNSNTTHQERDINRNFDENEIPQENGNASMISQQIIRSSTFPQTDVLSSSLEAEHR - UN

I28265 - RLLKEMGWQEDSENDETCAPLTEDEMREFQVISEQ - UNI2920 - - UNI16429 - LQKNGLRKNGILKNGLICDFKFGPWKNSTF

KPTIENDDTETSSSDTSDDDDV
Transcript ENSMUST00000116379
Sequence
GGACAGCTTTTCTAAATGAAGACATTGAAAGAATACAGCGTTTTTTTCTTTTTATCTTTTATTTACTTGGGAATGTAAGATGTTCCATTTTCACACCAGC

ATGGTAGTATTGAGATAGCTATTTGTCTATACACGCTGATGTTTAGAAGTAATCTTCAGATGTGAAATTTTTCTTTTTGTTTCTGCTTTTTGGCACATAA

ATTGGCTATTTCTTCTGGAGTGGATAAGTACAACAGTGACAAATACATGGAACAGTAAAGAAGACCTTGCTCTTAAATCCAAGGAACCTGGCTAACTCTG

GATCTGACCATATGAAAACTTCAAAGTAAATATGGGTAGCTGACTTCAAGTAACTCTATGTCAAATAGTCATAGGTTAAGTATCTTCAAAGAACTTGGAT

ATTTCAGAGGATACAAAATAAAAAAACAAACTGGAAAACATAAAGCTTATAGAGAAGAAATCAACACCTTCTTGTGCAGTCCTTTTGGAATTT - UNI6

99 - - UNI7503 - GGACTTGCCATGAGGTGTTGAAGCCTTGTTTCACTGAGTTGGAGAGACTGGACCTAAATGGCGCAGCATGACTTTGCTCCAGC

CTGGCTTAATTTTCCTACTCCTCCATCATCAACAAAG - UNI7503 - - UNI23348 - TCATCATTGAATTTTGAGAAGCACTCTGAAAATTTTT

CATGGACAGAAAATCGTTATGATGTGAGTCGTCGACGACACAATTCTTCAGATGGCTTTGATTCTGGTATTGGACGTCCTAATGGAG GTAATTTTGGGA

GGAAAGAGAAAAATGGATGGCGTACGCATGGCAGAAATGGTACAGAAAACATAAATCATCGTGGGGGATACCATGGTGGAAATTCCCGTTCTCGTAGCAG

TATTTTCCATTCTGGAAAAAGCCAAGGACTACATGAAAACAGCATCCCTGACAATGAAACTGGGAGGAAAGAAGACAAAAGAGAACGCAGACAGTTTGAG

GCTGAGGATTTT - UNI21418 - CCATCTTTAAATCCTGAATATGAGAGAGAACCAAATCAGAATAAATCTTTAGCTGCGGGTGTTTGGG - UNI9

203 - GCCTACACGCCCAGACACACACATACCCAACCAAAAAAATCTCCCAAGCTCCTCTCTTAG ACTATCCCCCGAATCCTAAATCTAGAACTCCAA

GAATGCTGGTCATTAAGAAAGGTAATACAAAAGACTTACAGCTATCTGGATTCCCAGTAGCAGGAAACCTCCAGTCACAGCCAGTTAAGAATGGAACTGG

TCCAAGTGTTTATAAAGGCTTAGTCCCCAAACCTGCTGTTCCACCTACAAAA CCTACACAATGGAAAAGCCAAACTAAAGAAAACAAAGTCGGGACTTC

TTTTTCTCATGAATCTACATATGGTGTTGGCAACTTTAATACTTTTAAGTCAACGGCCAAGAATATTAGTCCATCAACAAATTCAGTGAAAGAG - UNI

16482 - TGTAATCGTTCAAATTCTTCTTCGCCTGTTGACAAACTTAATCAGCAGCCTCGTTTAACTAAACTGACACGAATGCGCAGCGATAAAAAGAG

TGAATTTTTGAAAGCATTGAAAAGGGACAGAGTGGAGGAGGAACATGAAGATGAAAGTCATGCTGGCTCAGAGAAG - UNI7739 - GACGACGACTC

ATTTAATTTGCATAACAGCAATACTACTCACCAAGAAAGAGATATAAACAGAAACTTTGATGAAAATGAAATTCCACAGGAGAACGGCAATGCCTCGATG

ATTTCTCAACAGATCATTCGTTCTTCGACTTTTCCACAAACTGATGTTCTTTCCAGTTCACTAGAGGCAGAACACAG - UNI28265 - ATTATTAAA

AGAAATGGGCTGGCAGGAAGACAGTGAAAATGATGAAACATGTGCTCCCTTAACTGAGGATGAAATGAGAGAATTCCAAGTTATTAGTGAACAG - UNI

2920 - - UNI16429 - TTACAGAAGAATGGTCTGAGAAAAAATGGTATTTTGAAAAATGGCCTGATCTGTGACTTCAAGTTTGGACCCTGGAAAAA

CAGCACTTTCAAACCCACAATTGAGAATGATGACACAGAGACAAGTAGCAGCGACACGTCGGATGATGACGATGTGTGAAGGAGATCCTCACAGCTTTAG

AAATGTTAGTGTGATACATCTCTCATGCAGTTTGGGGTGAATTGTAAAAATGAAGAACTATAATTTATGTAGTGAACCTACCCCATTAGAAGATGATTTT

TTGGGGGACTTCGATATGAAGAAAACCAAGAATGTTGTGTTGGGCTGTGTTGAACATTATTTCTTTGTAAATGAATGTTGTAGAAATGAGGACTTTGGTT

GATCCAACATTGACTTTCTTCATCACTGCAGCATTTCTCTTGACTAGCAATGTGACGATGTAACAAATGAGATTTTCTCATTTAATAATAAAAAATTGTG

TGATGTTTTGC
Translation
 - UNI699 - - UNI7503 - MAQHDFAPAWLNFPTPPSSTK - UNI7503 - - UNI23348 - SSLNFEKHSENFSWTENRYDVSRRRHNSS

DGFDSGIGRPNGG GNFGRKEKNGWRTHGRNGTENINHRGGYHGGNSRSRSSIFHSGKSQGLHENSIPDNETGRKEDKRERRQFEAEDF - UNI21418

 - PSLNPEYEREPNQNKSLAAGVWG - UNI9203 - GLHAQTHTYPTKKISQAPLLD DYPPNPKSRTPRMLVIKKGNTKDLQLSGFPVAGNLQSQP

VKNGTGPSVYKGLVPKPAVPPTK PTQWKSQTKENKVGTSFSHESTYGVGNFNTFKSTAKNISPSTNSVKE - UNI16482 - CNRSNSSSPVDKLNQ

QPRLTKLTRMRSDKKSEFLKALKRDRVEEEHEDESHAGSEK - UNI7739 - DDDSFNLHNSNTTHQERDINRNFDENEIPQENGNASMISQQIIRSS

TFPQTDVLSSSLEAEHR - UNI28265 - RLLKEMGWQEDSENDETCAPLTEDEMREFQVISEQ - UNI2920 - - UNI16429 - LQKNGLRK

NGILKNGLICDFKFGPWKNSTFKPTIENDDTETSSSDTSDDDDV
Transcript ENSMUST00000047627
Sequence
TGAGACTGGTTGTGGGGGAGGGAAAAGCGGCAAAAGGGGATTATTCAAAGTACCGAAAACCTCCTCCCGGGATCGAGCGCAGCGGCACCCCCAGGCCAGG

GGCACCTCTGGTGGGGCAGAAG - UNI4031 - - UNI23500 - GTGGTTGAATTTGGCGTATGAAGATCATCATCTAGGTTTTGTTTAAAAGGCC

CCGGATATTTCAAGTGGCCATTTTGGAATTACAGTTTTGTTTTTGTTTTGGGCAATTTTGCTCCAGAAGTTCATTAAAATTGACAAGAATCATCTCTGAA

GTGAATTGATAGTAGTGAACAAATTCAACGAGCTACTAAAAGTCCCAGCCATTTCTTCAGTATTTTGGGTCAAACGGATTATATAAGTGGTTAAAGCATT

TCATCTGGTGTTATTTTTGTCTCTTTCCCCTCTCCTGTTTGTGTTCTTCAGCCAAAACTGTAAGATATGTTTGATTTGTGTACCAAGTAGTTTCAGCAGT

TTCAAATTACTGTTTAAATATTGCTGAAGTTTTGTGGCAGTTCTTTTTACCTTTATTAAAAGTTTTAGTAATTTTTGACTTCAGCTTTTTTCATATTACA

ATGGGACAGCTTTTCTAAATGAAGACATTGAAAGAATACAGCGTTTTTTTCTTTTTATCTTTTATTTACTTGGGAATGTAAGATGTTCCATTTTCACACC

AGCATGGTAGTATTGAGATAGCTATTTGTCTATACACGCTGATGTTTAGAAGTAATCTTCAGATGTGAAATTTTTCTTTTTGTTTCTGCTTTTTGGCACA

TAAATTGGCTATTTCTTCTGGAGTGGATAAGTACAACAGTGACAAATACATGGAACAGTAAAGAAGACCTTGCTCTTAAATCCAAGGAACCTGGCTAACT

CTGGATCTGACCATATGAAAACTTCAAAGTAAATATGGGTAGCTGACTTCAAGTAACTCTATGTCAAATAGTCATAGGTTAAGTATCTTCAAAGAACTTG

GATATTTCAGAGGATACAAAATAAAAAAACAAACTGGAAAACATAAAGCTTATAGAGAAGAAATCAACACCTTCTTGTGCAGTCCTTTTGGAATTT - U

NI699 - - UNI7503 - GGACTTGCCATGAGGTGTTGAAGCCTTGTTTCACTGAGTTGGAGAGACTGGACCTAAATGGCGCAGCATGACTTTGCTCC

AGCCTGGCTTAATTTTCCTACTCCTCCATCATCAACAAAG - UNI7503 - - UNI23348 - TCATCATTGAATTTTGAGAAGCACTCTGAAAATT

TTTCATGGACAGAAAATCGTTATGATGTGAGTCGTCGACGACACAATTCTTCAGATGGCTTTGATTCTGGTATTGGACGTCCTAATGGAG GTAATTTTG

GGAGGAAAGAGAAAAATGGATGGCGTACGCATGGCAGAAATGGTACAGAAAACATAAATCATCGTGGGGGATACCATGGTGGAAATTCCCGTTCTCGTAG

CAGTATTTTCCATTCTGGAAAAAGCCAAGGACTACATGAAAACAGCATCCCTGACAATGAAACTGGGAGGAAAGAAGACAAAAGAGAACGCAGACAGTTT

GAGGCTGAGGATTTT - UNI21418 - CCATCTTTAAATCCTGAATATGAGAGAGAACCAAATCAGAATAAATCTTTAGCTGCGGGTGTTTGGG - U

NI9203 - GCCTACACGCCCAGACACACACATACCCAACCAAAAAAATCTCCCAAGCTCCTCTCTTAG ACTATCCCCCGAATCCTAAATCTAGAACTC

CAAGAATGCTGGTCATTAAGAAAGGTAATACAAAAGACTTACAGCTATCTGGATTCCCAGTAGCAGGAAACCTCCAGTCACAGCCAGTTAAGAATGGAAC

TGGTCCAAGTGTTTATAAAGGCTTAGTCCCCAAACCTGCTGTTCCACCTACAAAA CCTACACAATGGAAAAGCCAAACTAAAGAAAACAAAGTCGGGAC

TTCTTTTTCTCATGAATCTACATATGGTGTTGGCAACTTTAATACTTTTAAGTCAACGGCCAAGAATATTAGTCCATCAACAAATTCAGTGAAAGAG - 

UNI16482 - TGTAATCGTTCAAATTCTTCTTCGCCTGTTGACAAACTTAATCAGCAGCCTCGTTTAACTAAACTGACACGAATGCGCAGCGATAAAAA

GAGTGAATTTTTGAAAGCATTGAAAAGGGACAGAGTGGAGGAGGAACATGAAGATGAAAGTCATGCTGGCTCAGAGAAG - UNI7739 - GACGACGA

CTCATTTAATTTGCATAACAGCAATACTACTCACCAAGAAAGAGATATAAACAGAAACTTTGATGAAAATGAAATTCCACAGGAGAACGGCAATGCCTCG

ATGATTTCTCAACAGATCATTCGTTCTTCGACTTTTCCACAAACTGATGTTCTTTCCAGTTCACTAGAGGCAGAACACAG - UNI28265 - ATTATT

AAAAGAAATGGGCTGGCAGGAAGACAGTGAAAATGATGAAACATGTGCTCCCTTAACTGAGGATGAAATGAGAGAATTCCAAGTTATTAGTGAACAG - 

UNI2920 - - UNI16429 - TTACAGAAGAATGGTCTGAGAAAAAATGGTATTTTGAAAAATGGCCTGATCTGTGACTTCAAGTTTGGACCCTGGAA

AAACAGCACTTTCAAACCCACAATTGAGAATGATGACACAGAGACAAGTAGCAGCGACACGTCGGATGATGACGATGTGTGAAGGAGATCCTCACAGCTT

TAGAAATGTTAGTGTGATACATCTCTCATGCAGTTTGGGGTGAATTGTAAAAATGAAGAACTATAATTTATGTAGTGAACCTACCCCATTAGAAGATGAT

TTTTTGGGGGACTTCGATATGAAGAAAACCAAGAATGTTGTGTTGGGCTGTGTTGAACATTATTTCTTTGTAAATGAATGTTGTAGAAATGAGGACTTTG

GTTGATCCAACATTGACTTTCTTCATCACTGCAGCATTTCTCTTGACTAGCAATGTGACGATGTAACAAATGAGATTTTCTCATTTAATAATAAAAAATT

GTGTGATGTTTTGCAAAGCTTCTGTCTTAAAATGTTCAGGTCTTAAGGTACAAGGCAGCTTACAGTTTTGCTTGCAGAGTCCTATCTTTTTCAAACTGTG

GAAATCTTCAACTCTACGTGTGCACCTCCTTATCCACTCCCCCTAAAACAAAACAACAGCAAAAAGGAAAATGTAGCATGTTGGCTAAAACCGGAGCAGA

GTGACTAAAACATTAGCTTCTTGAACTCAACTCTTGTACTAAGTCACCTTTCCAAACAAATTCCTCTTTAGTCTTTGGTAGCAGTGAATGTGGGAGAGGA

GACATGCCAGGCGCTCTTCCAAGCTTCAGGAGGGGCTTGTCAGGAGCTTTGTTCGGTGTGCTGTCAGATCAGGATTCTCAGAGGGGATTGCAAGAGTTGT

GGGAAAACTTATTTTGATAAATTATTACACATGCAGAAAACCTGATCACTGACTGGATCTGTCCACAACATGGAAAATAAACTGGATTTTCAG
Translation
 - UNI4031 - - UNI23500 -  - UNI699 - - UNI7503 - MAQHDFAPAWLNFPTPPSSTK - UNI7503 - - UNI23348 - SSL

NFEKHSENFSWTENRYDVSRRRHNSSDGFDSGIGRPNGG GNFGRKEKNGWRTHGRNGTENINHRGGYHGGNSRSRSSIFHSGKSQGLHENSIPDNETGR

KEDKRERRQFEAEDF - UNI21418 - PSLNPEYEREPNQNKSLAAGVWG - UNI9203 - GLHAQTHTYPTKKISQAPLLD DYPPNPKSRTPRM

LVIKKGNTKDLQLSGFPVAGNLQSQPVKNGTGPSVYKGLVPKPAVPPTK PTQWKSQTKENKVGTSFSHESTYGVGNFNTFKSTAKNISPSTNSVKE - 

UNI16482 - CNRSNSSSPVDKLNQQPRLTKLTRMRSDKKSEFLKALKRDRVEEEHEDESHAGSEK - UNI7739 - DDDSFNLHNSNTTHQERDIN

RNFDENEIPQENGNASMISQQIIRSSTFPQTDVLSSSLEAEHR - UNI28265 - RLLKEMGWQEDSENDETCAPLTEDEMREFQVISEQ - UNI29

20 - - UNI16429 - LQKNGLRKNGILKNGLICDFKFGPWKNSTFKPTIENDDTETSSSDTSDDDDV

For any suggestions or comments, please send an email to unitrap@crg.es