Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032786 (Alas1)
Chromosomal location
Chr 9: 106135794 - 106150187 (-)
Description
aminolevulinic acid synthase 1 Gene [Source:MGI Symbol;Acc:MGI:87989]
RefSeq_peptide
NP_065584.2 
UniGene
Mm.290578 
MGI
MGI:87989 
Uniprot/SWISSPROT
Q8VC19 
Uniprot/SPTREMBL
Q3V0B2 
Human Ortholog
ENSG00000023330 (ALAS1)
Omim not available
UniTrap UNI27134
Vector Insertion
Chr 9: 106149310 - 106149504
Public Clones not available
Private Clones OST68898 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6728
Vector Insertion
Chr 9: 106145727 - 106149089
Public Clones RHA203 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5492
Vector Insertion
Chr 9: 106144117 - 106145492
Public Clones YTA022 (baygenomics) YTA357 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21129
Vector Insertion
Chr 9: 106143670 - 106143966
Public Clones not available
Private Clones OST340538 (lexicon)
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000074082
Sequence
GAACAAGGGCACTGGTCGGTTTAGCGTCCTCCGCTCGAGTGCCTACCGCCGCTTCGTCGAGAGCCCGCGCAG - UNI27134 - GATCCAAGACACTT

TGCAAACATGGAGACTGTCGTTCGCCGATGCCCATTCTTATCCCGAGTCCCTCAGGCCTTTCTGCAGAAGGCAGGAAAGTCTCTGTTGTTCTATGCTCAA

AACTGCCCCAAGATGATGGAAGTTGGGGCCAAGCCAGCTCCTCGAACCCTGTCCACATCAGCTGTCCACTGCCAGCAGGTCAAAGAAACCCCTCCAGCCA

ATGAGA - UNI6728 - AAGAGAAAACTGCCAAGGCCGCAGTCCAGCAGGCTCCTGACGAGTCCCAGATGGCACAGACTCCAGACGGCACACAGCTTC

CGTCTGGACACCCGTCCCCTGCTACAAGCCAGGGCTCTGGGAGCAAGTGCCCTTTCCTGGCAGCACAGCTGAGCCAGACAGGCAGCAGCGTCTTCCGCAA

GGCCAGTCTGGAGCTCCAGGAGGACGTGCAGGAAATGCATGCTGTGAGGAAAG - UNI5492 - AGGCTGCTCAAAGCCCAGTGCCTCCCAGCCTGGT

TAATGTGAAAACCGATGGAGAGGATCCAAGCCGACTGCTGAAGAACTTCCAGGACATCATGCGAAAGCAGAGGCCAGAAAGAGTGTCTCATCTTCTTCAG

GATAACTTGCCAAAGT - UNI21129 - CTGTTTCCACTTTTCAATATGATCATTTCTTTGAGAAGAAAATTGATGAGAAAAAAAATGATCATACCTA

CCGAGTTTTTAAAACGGTGAACCGGAGAGCACAAATCTTCCCGATGGCGGATGACTACACGGATTCCCTCATAACCAAAAAGCAGGTGTCGGTCTGGTGC

AGTAATGACTACCTAGGCATGAGTCGACACCCACGGGTGTGTGGGGCTGTCAT GGAGACTGTGAAACAGCATGGTGCTGGAGCTGGGGGAACTAGGAAT

ATTTCTGGAACGAGCAAGTTCCACGTAGAACTGGAGCAGGCACTGGCCGACCTCCACGGCAAAGATGCGGCGCTCTTGTTCTCTTCCTGTTTTGTGGCCA

ACGACTCCACCCTCTTCACCCTGGCTAAGATGATGCCAG GCTGTGAAATTTACTCTGATTCCGGGAACCATGCCTCCATGATCCAAGGGATTCGCAACA

GTCGAGTGCCAAAATATATCTTCCGCCACAATGACGTTAACCATCTCAGAGAACTGCTGCAGAGATCTGACCCCTCAGTCCCCAAGATAGTAGCATTTGA

AACTGTCCATTCAATGGATG CAGTGTGCCCACTGGAAGAGCTGTGTGACGTGGCCCATGAGTTTGGGGCAATCACGTTTGTGGATGAGGTCCATGCAGT

GGGGCTCTATGGAGCTCGAGGTGGAGGGATCGGTGATCGGGATGGCGTCATGCCAAAAATGGACATCATCTCTGGGACGCTTG GTAAAGCGTTCGGCTG

TGTTGGAGGATACATTGCCAGCACGAGTTTGCTGATCGACACCGTCCGCTCCTACGCTGCGGGCTTCATCTTCACCACCTCCTTGCCACCAATGCTGCTG

GCTGGAGCCCTGGAGTCTGTGCGGATCCTGAAGAGCAGCGAGGGGCGCGCCCTTCGCCGCCAGCACCAGCGAAATGTCAAGCTTCTGAGGCAGATGCTAA

TGGACGCTGGCCTCCCGGTCATCCACTGTCCGAGTCACATCATCCCTGTGCGG GTTGCCGATGCTGCTAAGAACACAGAGATCTGTGATGAGTTGATGA

CCAGGCATAATATCTACGTCCAGGCCATCAATTACCCAACAGTGCCTCGCGGGGAGGAGCTCCTGCGGATCGCCCCCACCCCGCATCACACCCCGCAGAT

GATGAACTTCTTCGTGG AGAAGCTGCTGGTCACGTGGAAGCGAGTTGGGCTGGAACTTAAGCCACATTCGTCAGCTGAATGCAACTTCTGCAGGAGGCC

CCTGCACTTTGAAGTGATGAGCGAAAGAGAGAAAGCCTATTTCTCAGGCATGAGCAAGATGGTGTCTGCCCAGGCCTGACTCTGACTCAGTTATTCACAA

ACCCCAGGCCATTACCATACCCACATAGTAGCCAGAATTGTCTTTATATGTGAAATAAATTATATATTAAATCTTAATCTATAGT
Translation
 - UNI27134 - METVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRTLSTSAVHCQQVKETPPANEK - UNI6728 - KEKTAK

AAVQQAPDESQMAQTPDGTQLPSGHPSPATSQGSGSKCPFLAAQLSQTGSSVFRKASLELQEDVQEMHAVRKE - UNI5492 - EAAQSPVPPSLVNV

KTDGEDPSRLLKNFQDIMRKQRPERVSHLLQDNLPKS - UNI21129 - SVSTFQYDHFFEKKIDEKKNDHTYRVFKTVNRRAQIFPMADDYTDSLIT

KKQVSVWCSNDYLGMSRHPRVCGAVM METVKQHGAGAGGTRNISGTSKFHVELEQALADLHGKDAALLFSSCFVANDSTLFTLAKMMPG GCEIYSDSG

NHASMIQGIRNSRVPKYIFRHNDVNHLRELLQRSDPSVPKIVAFETVHSMDA AVCPLEELCDVAHEFGAITFVDEVHAVGLYGARGGGIGDRDGVMPKM

DIISGTLG GKAFGCVGGYIASTSLLIDTVRSYAAGFIFTTSLPPMLLAGALESVRILKSSEGRALRRQHQRNVKLLRQMLMDAGLPVIHCPSHIIPVR 

VADAAKNTEICDELMTRHNIYVQAINYPTVPRGEELLRIAPTPHHTPQMMNFFVE EKLLVTWKRVGLELKPHSSAECNFCRRPLHFEVMSEREKAYFSG

MSKMVSAQA
Transcript ENSMUST00000112524
Sequence
ACATGCCCCATCCCCCTCCGGCCACCACCTTGGCTCAGCGTCCATCCCCTGCTCTTTACCTCTCTACCTCTCGGGCTACCTCAGACGCCCCATTGCGTCC

CCTTCTGACATTCGACATTTGACAGGCGGCTTCGGAACTTCTTTCCTACCCTTTCCATTCTGACCCCAGGGAGCCTCTGACTCACTGCTGACCCCCTTTC

ACCCCTCCGACTCTTTGCGTTGTCTGGCCCTGCCCCTGACCGAGTCAGCCCTGACCCTTCCCTTCTTTCTGCCTCCTTTCCCGGTTCCAGCTGTAGGGGC

ATGACCTTGTCTCAGGGACTCAGGGCTGGTCTAGATTCTACCCCCTTCCTTGGATTGCTAGCATCCCCGGGAGTTCTCCCTACCTGGATAGGTGACAGTG

ACTTCTCCCCTACCCTCACTGTTGTTCCTGGGTGTGTGCTAAGATGTCTTAAACTACAGTGTTCACTCCTGGAGGAGCCTCTGGCCTCCTACACCTGTTC

TGCCTTGTTCTTCATCTCTTCTACACTCTTAAATATTAGTCGGCCCTACTTACTCTG - UNI27134 - GATCCAAGACACTTTGCAAACATGGAGAC

TGTCGTTCGCCGATGCCCATTCTTATCCCGAGTCCCTCAGGCCTTTCTGCAGAAGGCAGGAAAGTCTCTGTTGTTCTATGCTCAAAACTGCCCCAAGATG

ATGGAAGTTGGGGCCAAGCCAGCTCCTCGAACCCTGTCCACATCAGCTGTCCACTGCCAGCAGGTCAAAGAAACCCCTCCAGCCAATGAGA - UNI672

8 - AAGAGAAAACTGCCAAGGCCGCAGTCCAGCAGGCTCCTGACGAGTCCCAGATGGCACAGACTCCAGACGGCACACAGCTTCCGTCTGGACACCCGT

CCCCTGCTACAAGCCAGGGCTCTGGGAGCAAGTGCCCTTTCCTGGCAGCACAGCTGAGCCAGACAGGCAGCAGCGTCTTCCGCAAGGCCAGTCTGGAGCT

CCAGGAGGACGTGCAGGAAATGCATGCTGTGAGGAAAG - UNI5492 - AGGCTGCTCAAAGCCCAGTGCCTCCCAGCCTGGTTAATGTGAAAACCGA

TGGAGAGGATCCAAGCCGACTGCTGAAGAACTTCCAGGACATCATGCGAAAGCAGAGGCCAGAAAGAGTGTCTCATCTTCTTCAGGATAACTTGCCAAAG

T - UNI21129 - CTGTTTCCACTTTTCAATATGATCATTTCTTTGAGAAGAAAATTGATGAGAAAAAAAATGATCATACCTACCGAGTTTTTAAAAC

GGTGAACCGGAGAGCACAAATCTTCCCGATGGCGGATGACTACACGGATTCCCTCATAACCAAAAAGCAGGTGTCGGTCTGGTGCAGTAATGACTACCTA

GGCATGAGTCGACACCCACGGGTGTGTGGGGCTGTCAT GGAGACTGTGAAACAGCATGGTGCTGGAGCTGGGGGAACTAGGAATATTTCTGGAACGAGC

AAGTTCCACGTAGAACTGGAGCAGGCACTGGCCGACCTCCACGGCAAAGATGCGGCGCTCTTGTTCTCTTCCTGTTTTGTGGCCAACGACTCCACCCTCT

TCACCCTGGCTAAGATGATGCCAG GCTGTGAAATTTACTCTGATTCCGGGAACCATGCCTCCATGATCCAAGGGATTCGCAACAGTCGAGTGCCAAAAT

ATATCTTCCGCCACAATGACGTTAACCATCTCAGAGAACTGCTGCAGAGATCTGACCCCTCAGTCCCCAAGATAGTAGCATTTGAAACTGTCCATTCAAT

GGATG GAGCAGTGTGCCCACTGGAAGAGCTGTGTGACGTGGCCCATGAGTTTGGGGCAATCACGTTTGTGGATGAGGTCCATGCAGTGGGGCTCTATGG

AGCTCGAGGTGGAGGGATCGGTGATCGGGATGGCGTCATGCCAAAAATGGACATCATCTCTGGGACGCTTG GTAAAGCGTTCGGCTGTGTTGGAGGATA

CATTGCCAGCACGAGTTTGCTGATCGACACCGTCCGCTCCTACGCTGCGGGCTTCATCTTCACCACCTCCTTGCCACCAATGCTGCTGGCTGGAGCCCTG

GAGTCTGTGCGGATCCTGAAGAGCAGCGAGGGGCGCGCCCTTCGCCGCCAGCACCAGCGAAATGTCAAGCTTCTGAGGCAGATGCTAATGGACGCTGGCC

TCCCGGTCATCCACTGTCCGAGTCACATCATCCCTGTGCGG GTTGCCGATGCTGCTAAGAACACAGAGATCTGTGATGAGTTGATGACCAGGCATAATA

TCTACGTCCAGGCCATCAATTACCCAACAGTGCCTCGCGGGGAGGAGCTCCTGCGGATCGCCCCCACCCCGCATCACACCCCGCAGATGATGAACTTCTT

CGTGG AGAAGCTGCTGGTCACGTGGAAGCGAGTTGGGCTGGAACTTAAGCCACATTCGTCAGCTGAATGCAACTTCTGCAGGAGGCCCCTGCACTTTGA

AGTGATGAGCGAAAGAGAGAAAGCCTATTTCTCAGGCATGAGCAAGATGGTGTCTGCCCAGGCCTGACTCTGACTCAGTTATTCACAAACCCCAGGCCAT

TACCATACCCACATAGTAGCCAGAATTGTCTTTATATGTGAAATAAATTATATATTAAATCTTAATCTATAGTAAAATCATAGTCCTGGTTAGTGTGTTA

GGTGTTTCTGCTGTTGACCACTGAATGAAGAGCTAACTTTCATATGTGGTCTGTAGTATGGAGATATAAATTGTAATGCCTGCCAGGCCACCTGCTGGGC

TTAAACCTAACCTGGCAGACCCAGCTGGCACCCCAGAAACTACAAGCAGTGATACCGCCTGCTGTAGGGTTCCCTTCACACTTCTGCCTCAGACCCAGAA

GGGGCAGTCAGTGTGCCCACAGTCCTGTCGCTGCTCTTTCCTGCTTTCCCTCAGCCGCTGCCTCAACCTCACACTTCCCACTGAAAGTCAAGCCTGAAGG

AGAGCCCATCTATGCTTACCAAGGTTAGCAGCCAGCTAGCTCCTGACTCCTTGTCATGGCCTCTGCAAAGGGGATAGAGGCTTTGTGCATCTCCTCCACC

CTCTGCACTTGTATTTGGGTCTTGCTCTTTTTATACAATCT
Translation
 - UNI27134 - METVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRTLSTSAVHCQQVKETPPANEK - UNI6728 - KEKTAK

AAVQQAPDESQMAQTPDGTQLPSGHPSPATSQGSGSKCPFLAAQLSQTGSSVFRKASLELQEDVQEMHAVRKE - UNI5492 - EAAQSPVPPSLVNV

KTDGEDPSRLLKNFQDIMRKQRPERVSHLLQDNLPKS - UNI21129 - SVSTFQYDHFFEKKIDEKKNDHTYRVFKTVNRRAQIFPMADDYTDSLIT

KKQVSVWCSNDYLGMSRHPRVCGAVM METVKQHGAGAGGTRNISGTSKFHVELEQALADLHGKDAALLFSSCFVANDSTLFTLAKMMPG GCEIYSDSG

NHASMIQGIRNSRVPKYIFRHNDVNHLRELLQRSDPSVPKIVAFETVHSMDG GAVCPLEELCDVAHEFGAITFVDEVHAVGLYGARGGGIGDRDGVMPK

MDIISGTLG GKAFGCVGGYIASTSLLIDTVRSYAAGFIFTTSLPPMLLAGALESVRILKSSEGRALRRQHQRNVKLLRQMLMDAGLPVIHCPSHIIPVR

 VADAAKNTEICDELMTRHNIYVQAINYPTVPRGEELLRIAPTPHHTPQMMNFFVE EKLLVTWKRVGLELKPHSSAECNFCRRPLHFEVMSEREKAYFS

GMSKMVSAQA

For any suggestions or comments, please send an email to unitrap@crg.es